SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30124.Seq
         (669 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0835 + 8147177-8147359,8147871-8147968,8148045-8148102,814...    97   1e-20
04_04_1075 + 30634141-30634320,30634917-30635014,30635113-306351...    92   4e-19
08_02_1442 + 27120604-27120890,27121029-27121166,27121280-271213...    66   2e-11
10_06_0101 + 10736987-10737100,10737263-10737301,10737397-107374...    31   0.63 
02_03_0180 - 16031366-16031445,16031950-16032022,16032148-160321...    28   5.9  
09_02_0575 + 10845261-10847057                                         28   7.7  

>08_01_0835 +
           8147177-8147359,8147871-8147968,8148045-8148102,
           8148192-8148271,8148770-8148872,8148966-8149181
          Length = 245

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 49/104 (47%), Positives = 64/104 (61%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + RK+LQL RLRQI NGVF+++NKAT+NMLR  EPY+A+GYPNLKSVREL+         
Sbjct: 101 KTRKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKLN 160

Query: 535 DNVYQSLPTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
                     ++  G     +  +   +HEI TVG  FK A+NF
Sbjct: 161 KQRIPLQNNKVIEEGLGKHDIICIEDLVHEIMTVGPHFKEANNF 204



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL FV+RIRGIN + PK+ K    L
Sbjct: 76  GGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLL 109



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +3

Query: 75  KLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERD 248
           K   VPESVLK             +  L  +  A++ ++ IF RA+QY +EY  +E++
Sbjct: 7   KAAVVPESVLKKRKREEQWAADRKEKALAEKKKAVESRKLIFARAKQYAQEYDAQEKE 64


>04_04_1075 +
           30634141-30634320,30634917-30635014,30635113-30635170,
           30635259-30635338,30635686-30635788,30635847-30636080
          Length = 250

 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 52/112 (46%), Positives = 70/112 (62%), Gaps = 8/112 (7%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV--------S 510
           + RK+LQL RLRQI NGVF+++NKAT+NMLR  EPY+A+GYPNLKSVREL+        +
Sbjct: 100 KTRKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKLN 159

Query: 511 NVDSPS*VDNVYQSLPTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
               P   + V +   +  L +G     +  +   +HEI TVG  FK A+NF
Sbjct: 160 KQRIPLTNNKVIEE--SWCLYQGLGKHDIICIEDLVHEIMTVGPHFKEANNF 209



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 6/54 (11%)
 Frame = +3

Query: 471 GIPQLKECP*VSIKRGFAKLSGQRIPITSNSIVEKR------LHKHNIICVEDL 614
           G P LK    +  KRG+ KL+ QRIP+T+N ++E+       L KH+IIC+EDL
Sbjct: 139 GYPNLKSVRELIYKRGYGKLNKQRIPLTNNKVIEESWCLYQGLGKHDIICIEDL 192



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/34 (52%), Positives = 22/34 (64%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  E KL FV+RIRGIN + PK+ K    L
Sbjct: 75  GGFYVSPEEKLLFVVRIRGINAMHPKTRKILQLL 108



 Score = 35.9 bits (79), Expect = 0.029
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 87  VPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERD 248
           VPESVL+             +  +  +  +I+ ++ IF RA+QY +EY  +E++
Sbjct: 10  VPESVLRKRKREEVWAAASKEKAVAEKKKSIESRKLIFSRAKQYAEEYEAQEKE 63


>08_02_1442 +
           27120604-27120890,27121029-27121166,27121280-27121382,
           27121877-27122036,27122927-27123114,27123203-27124770,
           27124882-27125869,27126595-27127098,27127347-27127433,
           27127753-27127821,27128012-27128041
          Length = 1373

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 33/103 (32%), Positives = 56/103 (54%)
 Frame = +1

Query: 358 VRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VD 537
           +R++L+  RL Q+  GVF++   AT+  L + EP+I +G+PNLK+V++L+          
Sbjct: 104 MRRILRKLRLTQVLTGVFLKATDATMKRLLVVEPFITYGFPNLKNVKDLIYKKGRGFLDK 163

Query: 538 NVYQSLPTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
             +      L+ +      +  L   +HEI +VG  F+ ASNF
Sbjct: 164 EPFPLTSNDLIEKALGEYGIICLEDLVHEIASVGPHFREASNF 206


>10_06_0101 +
           10736987-10737100,10737263-10737301,10737397-10737474,
           10737539-10737685,10737781-10737888,10738115-10738449,
           10738572-10739544,10739702-10739980
          Length = 690

 Score = 31.5 bits (68), Expect = 0.63
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +3

Query: 153 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEID 257
           TL+ R+  IK KRE+F+R     KE+RI+E  ++D
Sbjct: 149 TLETRTDPIKLKREVFRRKR---KEHRIQELLQVD 180


>02_03_0180 - 16031366-16031445,16031950-16032022,16032148-16032186,
            16032434-16032715,16032790-16032948,16033034-16033390,
            16033482-16033622,16033919-16034045,16034121-16034263,
            16034740-16034917,16035019-16035552,16035628-16035812,
            16036551-16036637,16036710-16036850,16036896-16037175,
            16037944-16038020,16038326-16039138,16039292-16039801,
            16039926-16040056,16040192-16040246,16040364-16040564,
            16040640-16040909,16041103-16041184,16041271-16041434,
            16041532-16041690,16041762-16042083,16042158-16042544,
            16042811-16042999,16043233-16043317,16043458-16043753,
            16043862-16043965,16044484-16044513,16044602-16044817,
            16044923-16045540,16045718-16045993,16046619-16046762,
            16046854-16046962,16047291-16047475,16047557-16047670,
            16048348-16048479,16048929-16049249,16049424-16049891,
            16054482-16054547,16054691-16054828,16054917-16055015,
            16057098-16057194,16057661-16057761,16057858-16058085,
            16059175-16059381,16059451-16059571,16059921-16059988,
            16060148-16060213,16060396-16060509,16060949-16061300,
            16063571-16063663,16063764-16063922,16064224-16064287,
            16064385-16064577,16064673-16064710,16065510-16065645,
            16065726-16065914,16065994-16066095,16067660-16067777,
            16067861-16067964,16070338-16070346,16071428-16071475,
            16071581-16071676,16072430-16072533,16073964-16074045,
            16076573-16076601,16076708-16076963
          Length = 4246

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 20/80 (25%), Positives = 32/80 (40%)
 Frame = -2

Query: 620  WMKVLNTDNVVFMEPLLNNAVGSDWYTLSTQLGESTFDTNSRTLFKLGYPQAM*GSAIRS 441
            W    + D    M  L+NN  G+D   +   +   T  +    +F+L    +      RS
Sbjct: 3489 WSTPFSIDANGVMCVLMNNTTGNDQALVRVNVRSGTKCSRYEVVFQLACWSSPYRVENRS 3548

Query: 440  IFTVALFRRTNTPLFIWRSL 381
            +F    FR+     + WRSL
Sbjct: 3549 MFLPVRFRQVGGDDYSWRSL 3568


>09_02_0575 + 10845261-10847057
          Length = 598

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%)
 Frame = -3

Query: 544 IRCPLSLANPRLILTHGHSL---SWGIPKQCKARRYV 443
           +RC   L N +L+L    SL   SW +  +C+ RRY+
Sbjct: 447 LRCIFLLNNWQLVLHRIESLDLPSWALIDRCRTRRYI 483


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,411,406
Number of Sequences: 37544
Number of extensions: 328868
Number of successful extensions: 754
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 730
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 749
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1691314196
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -