SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998    152   3e-37
06_03_1086 - 27494238-27494914,27495471-27495740,27495986-27496379    151   7e-37
02_01_0499 + 3619909-3620302,3621123-3621392,3621788-3622467          150   9e-37
05_04_0306 + 20058640-20059159,20060406-20060819,20060921-200611...   147   6e-36
03_01_0034 + 318432-318825,318902-319851                              147   6e-36
01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349    147   6e-36
01_06_1060 + 34162161-34162554,34162613-34162675,34163262-341635...   142   2e-34
03_05_0575 + 25747813-25748206,25748567-25748614,25750296-257505...   140   1e-33
11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535,788...    87   2e-17
07_03_0994 + 23190344-23190456,23191367-23191581,23191663-231918...    86   2e-17
03_05_0974 + 29324025-29324117,29325064-29325298,29325385-293257...    86   3e-17
03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557,624...    83   2e-16
05_01_0412 - 3248405-3248458,3248533-3248637,3248950-3249078,324...    60   1e-09
06_03_1025 - 26980631-26981286,26981434-26981557,26982290-269824...    31   0.87 
12_01_0633 - 5241098-5241283,5241361-5241453,5241555-5241615,524...    30   2.0  
08_01_0431 + 3779519-3780393,3780402-3780768                           29   2.6  
05_07_0031 - 27183252-27183317,27183542-27184282                       29   3.5  
12_02_0931 + 24512496-24512567,24512705-24512806,24512939-245129...    29   4.6  
03_02_0319 - 7421357-7421757,7421768-7421843,7424695-7424796,742...    29   4.6  
03_05_1091 + 30322035-30322739,30322861-30324043,30324114-303251...    28   6.1  
05_03_0485 + 14608663-14608989,14609265-14609535,14609720-146098...    28   8.1  

>03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998
          Length = 444

 Score =  152 bits (368), Expect = 3e-37
 Identities = 76/145 (52%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G+YVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEASGGRYVPRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMLTFSVFPSPKVSDTVVEPYNATL 187



 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 30/42 (71%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVI DEHG+D +G Y GDSDL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGVDATGRYAGDSDL 42



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 177


>06_03_1086 - 27494238-27494914,27495471-27495740,27495986-27496379
          Length = 446

 Score =  151 bits (365), Expect = 7e-37
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G+YVPR VL+DL+P TMD+VRSGP+G +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEASGGRYVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMLTFSVFPSPKVSDTVVEPYNATL 187



 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 31/42 (73%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVI DEHGID +G Y GDSDL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDL 42



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 177


>02_01_0499 + 3619909-3620302,3621123-3621392,3621788-3622467
          Length = 447

 Score =  150 bits (364), Expect = 9e-37
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G++VPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEASGGRFVPRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMLTFSVFPSPKVSDTVVEPYNATL 187



 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 31/42 (73%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVI DEHGID +G Y GDSDL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDL 42



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 177


>05_04_0306 +
           20058640-20059159,20060406-20060819,20060921-20061190,
           20062179-20062849
          Length = 624

 Score =  147 bits (357), Expect = 6e-36
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLER+NVYYNEAS G++VPR VL+DL+P TMD+VR+GP+G +FRPDNFV+GQ+ A NNWA
Sbjct: 223 QLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWA 282

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 283 KGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 342

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 343 MMLTFSVFPSPKVSDTVVEPYNATL 367



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 31/43 (72%), Positives = 36/43 (83%)
 Frame = +1

Query: 127 KMREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           KMREI+++Q G CGNQIG KFWEV+ DEHGIDP+G Y G SDL
Sbjct: 180 KMREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDL 222



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 308 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 357


>03_01_0034 + 318432-318825,318902-319851
          Length = 447

 Score =  147 bits (357), Expect = 6e-36
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLER+NVYYNEAS G++VPR VL+DL+P TMD+VRSGP+G +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMLTFSVFPSPKVSDTVVEPYNATL 187



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 29/42 (69%), Positives = 34/42 (80%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEV+  EHGID +G Y GDSDL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYDGDSDL 42



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 177


>01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349
          Length = 447

 Score =  147 bits (357), Expect = 6e-36
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLER+NVYYNEAS G++VPR VL+DL+P TMD+VR+GP+G +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   V  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F  P+    VVEPYN TL
Sbjct: 163 MMLTFSVFPSPKVSDTVVEPYNATL 187



 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 30/42 (71%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEV+ DEHGIDP+G Y G SDL
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDL 42



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 DCLQVFR-CHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+ CH+              +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 128 DCLQGFQVCHS-LGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSD 177


>01_06_1060 +
           34162161-34162554,34162613-34162675,34163262-34163531,
           34163944-34164623
          Length = 468

 Score =  142 bits (345), Expect = 2e-34
 Identities = 59/83 (71%), Positives = 75/83 (90%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLER+NVYYNEAS G++VPR VL+DL+P TMD+VR+GP+G +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAE 503
           KGHYTEG E+++S LDV+R+EAE
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAE 125



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 30/42 (71%), Positives = 36/42 (85%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEV+ DEHGIDP+G Y G+SDL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDL 42



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 20/26 (76%), Positives = 26/26 (100%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVSD 658
           +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 173 ISKIREEYPDRMMLTFSVFPSPKVSD 198


>03_05_0575 +
           25747813-25748206,25748567-25748614,25750296-25750565,
           25750658-25751334
          Length = 462

 Score =  140 bits (338), Expect = 1e-33
 Identities = 59/83 (71%), Positives = 74/83 (89%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVY+NEAS G++VPR VL+DL+P TMD++RSGP G +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYFNEASGGRHVPRAVLMDLEPGTMDSLRSGPIGGIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAE 503
           KGHYTEG E+++S LDV+R+EAE
Sbjct: 103 KGHYTEGAELIDSVLDVVRKEAE 125



 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 27/40 (67%), Positives = 32/40 (80%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDS 249
           MREI+++Q G CGNQIG KFWEVI  EHG+DP+G Y G S
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICGEHGVDPTGTYTGTS 40



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 20/26 (76%), Positives = 26/26 (100%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVSD 658
           +++IREEYPDR++LTFSVFPSP+VSD
Sbjct: 168 ISKIREEYPDRMMLTFSVFPSPKVSD 193


>11_02_0058 +
           7879859-7879951,7880844-7881078,7881165-7881535,
           7881648-7882304
          Length = 451

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 37/81 (45%), Positives = 56/81 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  LD IR+ A+
Sbjct: 107 HYTIGKEIVDLCLDRIRKLAD 127



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/39 (46%), Positives = 23/39 (58%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGD 246
           MRE I++ +G  G Q+G   WE+   EHGI P G   GD
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39


>07_03_0994 +
           23190344-23190456,23191367-23191581,23191663-23191862,
           23192420-23192928,23193048-23193363
          Length = 450

 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 35/81 (43%), Positives = 56/81 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR + +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  LD +R+ A+
Sbjct: 107 HYTVGKEIVDLCLDRVRKLAD 127



 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 18/40 (45%), Positives = 25/40 (62%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDS 249
           MREII++ +G  G Q+G   WE+   EHGI+P G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDT 40


>03_05_0974 +
           29324025-29324117,29325064-29325298,29325385-29325755,
           29325864-29326520
          Length = 451

 Score = 85.8 bits (203), Expect = 3e-17
 Identities = 37/81 (45%), Positives = 56/81 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  LD IR+ A+
Sbjct: 107 HYTIGKEIVDLCLDRIRKLAD 127



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE I++ +G  G Q+G   WE+   EHGI   G
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQADG 34


>03_02_0186 -
           6243487-6243799,6243892-6244400,6244495-6244557,
           6245482-6245681,6246125-6246519,6246776-6246888
          Length = 530

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 33/81 (40%), Positives = 57/81 (70%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E S+GK+VPR + +DL+P  +D V++GP+  LF P+  +  +  AANN+A+G
Sbjct: 107 DAFNTFFSETSSGKHVPRALFVDLEPTVIDEVKTGPYRQLFHPEQLISYKEDAANNFARG 166

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G E+++  LD +R+ A+
Sbjct: 167 HYTVGREVVDLCLDRLRKLAD 187



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/40 (45%), Positives = 24/40 (60%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDS 249
           MREII++ +G  G Q+G   WE+   EHGI P G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPRDA 40


>05_01_0412 -
           3248405-3248458,3248533-3248637,3248950-3249078,
           3249279-3249353,3249520-3249624,3249714-3249767,
           3249970-3250370,3250583-3250694,3250886-3251086,
           3251844-3251972
          Length = 454

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 26/84 (30%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR +L+DL+P  ++ +++  +  L+  +N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDQHYIPRALLVDLEPRVINGIQNSEYRNLYNHENIFVAEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G Y +G ++++  +D+I REA+G
Sbjct: 106 SG-YHQGEQVVDDIMDMIDREADG 128



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 20/33 (60%), Positives = 24/33 (72%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII +QVG CGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITIQVGQCGNQIGMEFWKQLCLEHGIGKDG 35


>06_03_1025 -
           26980631-26981286,26981434-26981557,26982290-26982426,
           26983220-26983355,26983615-26983922,26985159-26985207
          Length = 469

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 23/96 (23%), Positives = 40/96 (41%), Gaps = 1/96 (1%)
 Frame = -3

Query: 464 NLYSFSVVSLRPVVGRTVLSVDEIVRSE*ASEGSRPHRVHRGRL-QVDKNRARNIFPSRC 288
           ++Y F VV L  ++GR  +      R     E +RP  VH  +L ++   R    + ++ 
Sbjct: 259 DVYGFGVVLLEMIIGRRAVDKSRPSREHNLVEWARPLLVHNRKLFRIIDPRMEGQYSTKA 318

Query: 287 LVVVHVDPFELRSESPW*HPLGSMPCSSDITSQNFP 180
            + V    +   S++P   P  S    +    QN P
Sbjct: 319 AIEVAGLAYRCLSQNPKGRPTMSQVVETFEAVQNMP 354


>12_01_0633 -
           5241098-5241283,5241361-5241453,5241555-5241615,
           5241703-5241813,5241960-5242145,5242229-5242590,
           5242730-5243152,5243159-5244382,5244468-5244707
          Length = 961

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +1

Query: 205 DEHGIDPSGCYHGDSDLNSKGSTCTTTRHR 294
           D HG   +GC H D    ++G  C T+R +
Sbjct: 602 DSHGDSSAGCAHRDYSGRTRGGICGTSREK 631


>08_01_0431 + 3779519-3780393,3780402-3780768
          Length = 413

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 16/53 (30%), Positives = 21/53 (39%)
 Frame = +1

Query: 190 WEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGNMFLARFLST*SRPRW 348
           W  + D+  I   G      DL   G+ C+T R         R  ST +RP W
Sbjct: 10  WSALPDDVVITVMGYLADPDDLVRSGAVCSTWRAAYATFRRLRLPSTTARPPW 62


>05_07_0031 - 27183252-27183317,27183542-27184282
          Length = 268

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = -3

Query: 410 LSVDEIVRSE*ASEGSRPHRVHRGRLQVDKNRARNIFPSRCLVVVHVDPFELRSE 246
           L+ +EI     A  GSRP R  R R +V + +  ++FP   L  V  D + +  E
Sbjct: 214 LTPEEIEEDIYALTGSRPRRRPRKRPRVVQRQLDSLFPGLWLTEVTADAYRVPDE 268


>12_02_0931 +
           24512496-24512567,24512705-24512806,24512939-24512984,
           24513292-24513355,24513997-24514348,24514497-24514749,
           24515069-24515311,24515399-24515518,24515710-24516158
          Length = 566

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFW 192
           MRE + +QVG   N +G  FW
Sbjct: 1   MREAVTVQVGGFANYVGSHFW 21


>03_02_0319 -
           7421357-7421757,7421768-7421843,7424695-7424796,
           7424911-7424982
          Length = 216

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFW 192
           MRE + +QVG   N +G  FW
Sbjct: 1   MREAVTVQVGGFANYVGSHFW 21


>03_05_1091 + 30322035-30322739,30322861-30324043,30324114-30325105,
            30326409-30326798,30326896-30330060
          Length = 2144

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +3

Query: 300  KYVPRTVLIDLKPATMDAVRSGPFGCLF 383
            KY P T LIDL+P  + A+R+  +  L+
Sbjct: 1298 KYAPPTELIDLQPLPVTALRNARYESLY 1325


>05_03_0485 +
           14608663-14608989,14609265-14609535,14609720-14609830,
           14609870-14610423
          Length = 420

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 7/65 (10%)
 Frame = +3

Query: 330 LKPATMDAVRSG--PFGCLFRPDNFVYGQNCAANNWAK-----GHYTEGVEILESALDVI 488
           +K  + D VR    PF  L R  ++ Y  + A N W K      H  +  E+L + LD++
Sbjct: 69  IKGVSPDTVRLRLFPFSLLGRAKHWFYANSAAVNTWDKCSMRGMHTVKETELLTAKLDLL 128

Query: 489 RREAE 503
            +  +
Sbjct: 129 MKRLD 133


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,717,004
Number of Sequences: 37544
Number of extensions: 391881
Number of successful extensions: 1161
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1053
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1160
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1768474200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -