SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30122.Seq
         (669 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0835 + 8147177-8147359,8147871-8147968,8148045-8148102,814...    97   1e-20
04_04_1075 + 30634141-30634320,30634917-30635014,30635113-306351...    92   4e-19
08_02_1442 + 27120604-27120890,27121029-27121166,27121280-271213...    63   2e-10
10_06_0101 + 10736987-10737100,10737263-10737301,10737397-107374...    31   0.63 
01_04_0043 + 15375459-15377606                                         30   1.5  
09_02_0575 + 10845261-10847057                                         28   7.7  

>08_01_0835 +
           8147177-8147359,8147871-8147968,8148045-8148102,
           8148192-8148271,8148770-8148872,8148966-8149181
          Length = 245

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 46/88 (52%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + RK+LQL RLRQI NGVF+++NKAT+NMLR  EPY+A+GYPNLKSVREL+         
Sbjct: 101 KTRKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKLN 160

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                     ++  G  KH+IIC+EDL+
Sbjct: 161 KQRIPLQNNKVIEEGLGKHDIICIEDLV 188



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  EAKL FV+RIRGIN + PK+ K    L
Sbjct: 76  GGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLL 109



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +3

Query: 75  KLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERD 248
           K   VPESVLK             +  L  +  A++ ++ IF RA+QY +EY  +E++
Sbjct: 7   KAAVVPESVLKKRKREEQWAADRKEKALAEKKKAVESRKLIFARAKQYAQEYDAQEKE 64


>04_04_1075 +
           30634141-30634320,30634917-30635014,30635113-30635170,
           30635259-30635338,30635686-30635788,30635847-30636080
          Length = 250

 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 49/96 (51%), Positives = 66/96 (68%), Gaps = 8/96 (8%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV--------S 510
           + RK+LQL RLRQI NGVF+++NKAT+NMLR  EPY+A+GYPNLKSVREL+        +
Sbjct: 100 KTRKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKLN 159

Query: 511 NVDSPS*VDNVYQSLPTALLRRGFHKHNIICVEDLI 618
               P   + V +   +  L +G  KH+IIC+EDL+
Sbjct: 160 KQRIPLTNNKVIEE--SWCLYQGLGKHDIICIEDLV 193



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/34 (52%), Positives = 22/34 (64%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  E KL FV+RIRGIN + PK+ K    L
Sbjct: 75  GGFYVSPEEKLLFVVRIRGINAMHPKTRKILQLL 108



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +3

Query: 471 GIPQLKECP*VSIKRGFAKLSGQRIPITSNSIVEK 575
           G P LK    +  KRG+ KL+ QRIP+T+N ++E+
Sbjct: 139 GYPNLKSVRELIYKRGYGKLNKQRIPLTNNKVIEE 173



 Score = 35.9 bits (79), Expect = 0.029
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 87  VPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERD 248
           VPESVL+             +  +  +  +I+ ++ IF RA+QY +EY  +E++
Sbjct: 10  VPESVLRKRKREEVWAAASKEKAVAEKKKSIESRKLIFSRAKQYAEEYEAQEKE 63


>08_02_1442 +
           27120604-27120890,27121029-27121166,27121280-27121382,
           27121877-27122036,27122927-27123114,27123203-27124770,
           27124882-27125869,27126595-27127098,27127347-27127433,
           27127753-27127821,27128012-27128041
          Length = 1373

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 28/87 (32%), Positives = 51/87 (58%)
 Frame = +1

Query: 358 VRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VD 537
           +R++L+  RL Q+  GVF++   AT+  L + EP+I +G+PNLK+V++L+          
Sbjct: 104 MRRILRKLRLTQVLTGVFLKATDATMKRLLVVEPFITYGFPNLKNVKDLIYKKGRGFLDK 163

Query: 538 NVYQSLPTALLRRGFHKHNIICVEDLI 618
             +      L+ +   ++ IIC+EDL+
Sbjct: 164 EPFPLTSNDLIEKALGEYGIICLEDLV 190


>10_06_0101 +
           10736987-10737100,10737263-10737301,10737397-10737474,
           10737539-10737685,10737781-10737888,10738115-10738449,
           10738572-10739544,10739702-10739980
          Length = 690

 Score = 31.5 bits (68), Expect = 0.63
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +3

Query: 153 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEID 257
           TL+ R+  IK KRE+F+R     KE+RI+E  ++D
Sbjct: 149 TLETRTDPIKLKREVFRRKR---KEHRIQELLQVD 180


>01_04_0043 + 15375459-15377606
          Length = 715

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = -3

Query: 658 RVLELFSNSEDLME*GPQHR*CCVYGSLFSTMLLEVIGIRCPLSLANPR 512
           R+  LFS+ + L+   PQ +  C+  +LF   L   +G  CP++ A  R
Sbjct: 234 RICRLFSSGDPLVASNPQIKDTCLSFALFKLQLRRFVG--CPIAEAGSR 280


>09_02_0575 + 10845261-10847057
          Length = 598

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%)
 Frame = -3

Query: 544 IRCPLSLANPRLILTHGHSL---SWGIPKQCKARRYV 443
           +RC   L N +L+L    SL   SW +  +C+ RRY+
Sbjct: 447 LRCIFLLNNWQLVLHRIESLDLPSWALIDRCRTRRYI 483


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,355,548
Number of Sequences: 37544
Number of extensions: 325797
Number of successful extensions: 758
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 730
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 754
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1691314196
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -