SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30120.Seq
         (576 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_1370 - 32990002-32990244,32990950-32991943,32992019-329922...    50   1e-06
07_01_0292 - 2117212-2117326,2117402-2117527,2117654-2117791,211...    31   0.50 
10_08_0050 + 14469879-14470072,14470620-14471094                       31   0.87 
12_02_0625 - 21331209-21331273,21331364-21331555,21332348-213325...    29   2.0  
05_01_0029 + 187769-188707,188971-189246,189978-190174,190263-19...    29   2.7  
09_01_0117 + 1808669-1809181,1810038-1810059,1810170-1810223,181...    29   3.5  
04_04_1220 + 31843628-31844755                                         29   3.5  
03_05_0355 - 23420410-23420548,23420643-23420794                       28   4.6  
08_01_0333 + 2977397-2977648,2978416-2978784,2980108-2980169,298...    27   8.1  
07_03_0251 + 15831712-15832127,15832203-15832344,15832692-158330...    27   8.1  

>04_04_1370 -
           32990002-32990244,32990950-32991943,32992019-32992240,
           32993413-32993543
          Length = 529

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 23/36 (63%), Positives = 29/36 (80%)
 Frame = -2

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q+QADLLG PV+RP  +E+TALGAA  AG A+ VW
Sbjct: 446 MQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVW 481


>07_01_0292 -
           2117212-2117326,2117402-2117527,2117654-2117791,
           2117904-2118323,2118421-2118591,2118701-2118880,
           2118988-2119140,2119226-2119384,2119841-2120152,
           2120285-2120452,2120851-2121050,2122207-2122589,
           2123244-2123625
          Length = 968

 Score = 31.5 bits (68), Expect = 0.50
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 1/67 (1%)
 Frame = +3

Query: 351 GKSRQECIGRWAGYCRGPHTHCA-TCDNGRPQGCTFHHEGTNDWYTQ*ISLHLHRTEFCA 527
           G+S  EC  RW  +     +H A T    +    T   +G N+W    ++L  HRT F  
Sbjct: 369 GRSGAECESRWLNFDDPLISHNAWTAREEKRLILTVQQQGMNNWINIAVTLGTHRTPFQC 428

Query: 528 IPPSARS 548
           +    RS
Sbjct: 429 LVRYQRS 435


>10_08_0050 + 14469879-14470072,14470620-14471094
          Length = 222

 Score = 30.7 bits (66), Expect = 0.87
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = -2

Query: 293 GWTDTKNEHVNAENQIELLQFCRRD 219
           G+T T ++  N+ N  E+L+FCRR+
Sbjct: 101 GFTSTSSDRSNSGNSSEMLRFCRRE 125


>12_02_0625 -
           21331209-21331273,21331364-21331555,21332348-21332558,
           21333600-21333700,21333839-21333844,21333956-21334051,
           21334485-21334497
          Length = 227

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 17/47 (36%), Positives = 21/47 (44%)
 Frame = -2

Query: 512 SVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPAD 372
           S  +QADLLG PVIRP           + AG  ++        PP D
Sbjct: 38  SAHLQADLLGSPVIRPSEPLELQKQLELAAGIWIKAVDPAFGLPPVD 84


>05_01_0029 + 187769-188707,188971-189246,189978-190174,190263-190404,
            190584-190862,190941-191013,191331-191379,192169-192433,
            192576-192631,192777-192845,193028-193139,193682-193771,
            193955-194125,194449-194506,194970-195128,195379-195401
          Length = 985

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 13/28 (46%), Positives = 14/28 (50%)
 Frame = +2

Query: 365  GMYRPVGWVLSWATHALRDLRQWPPPGL 448
            G   PVGW L + T  L D    PPP L
Sbjct: 926  GNNNPVGWPLRFLTPVLSDENSVPPPSL 953


>09_01_0117 +
           1808669-1809181,1810038-1810059,1810170-1810223,
           1810684-1810892
          Length = 265

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 18/62 (29%), Positives = 27/62 (43%)
 Frame = -2

Query: 539 RRRDGAELSSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPADTFLP 360
           RRR  + L +    A   G P+          + AA++ G A     T+ P PP+ T  P
Sbjct: 98  RRRHSSHLFAAPRHASTAGAPIATLRYSAVLGIEAAVLVGTARD--STSSPIPPSSTGAP 155

Query: 359 AL 354
           +L
Sbjct: 156 SL 157


>04_04_1220 + 31843628-31844755
          Length = 375

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = -1

Query: 441 GGGHCRRSRNACVAHDNTQPT 379
           GGGH R  R +CV  D+ +P+
Sbjct: 231 GGGHMRERRTSCVVVDDMEPS 251


>03_05_0355 - 23420410-23420548,23420643-23420794
          Length = 96

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = +1

Query: 415 ARPATMAAPRAVLSIMRGRMTGIPSKSACICTELS 519
           ARP   AA     + +  R+TG PS S   C ELS
Sbjct: 50  ARPMAAAAMMGSPAAVAARLTGHPSASVRACCELS 84


>08_01_0333 +
           2977397-2977648,2978416-2978784,2980108-2980169,
           2980271-2980418
          Length = 276

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = -2

Query: 515 SSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPADTFLPALT 351
           +++ M A L+G P   P M  +  +GAA+  G   ++W   + +PP      A T
Sbjct: 218 AAIMMNA-LVGGPSTGPSMNPARTIGAAVATGEYRQMW-IYLVAPPLGAIAGAAT 270


>07_03_0251 +
           15831712-15832127,15832203-15832344,15832692-15833056,
           15833134-15833293,15833699-15834036,15834138-15834315,
           15834454-15834987,15835176-15836291
          Length = 1082

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 9/23 (39%), Positives = 16/23 (69%)
 Frame = -2

Query: 290 WTDTKNEHVNAENQIELLQFCRR 222
           WT+ +   +N ++  ELL+FCR+
Sbjct: 780 WTEAEQGRLNYKDSDELLEFCRK 802


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,737,823
Number of Sequences: 37544
Number of extensions: 363363
Number of successful extensions: 1008
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 978
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1008
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1340735508
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -