SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30119.Seq
         (448 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_02_0140 + 12255418-12255512,12257514-12257793                      105   2e-23
08_02_1181 - 24985963-24986242,24987109-24987197                      102   2e-22
02_05_0532 - 29814199-29814478,29814922-29814969,29815558-29815649     85   3e-17
01_06_0668 + 31058497-31059510,31059609-31059676,31060189-310602...    29   1.7  
03_02_0001 + 4844009-4844046,4845155-4845410,4845560-4845704,484...    27   6.9  
03_02_0178 + 6195402-6199158,6199438-6200003                           27   9.1  

>06_02_0140 + 12255418-12255512,12257514-12257793
          Length = 124

 Score =  105 bits (252), Expect = 2e-23
 Identities = 48/74 (64%), Positives = 57/74 (77%)
 Frame = +3

Query: 54  KGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTR 233
           K +R G +  +EVVTREYT+NLHKRLHG  FKK+AP AIKEIRKFA+K MGT D+RVD +
Sbjct: 4   KKQRPGGARKDEVVTREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTIDVRVDVK 63

Query: 234 LNKFLWSRGSEMFP 275
           LNK +WS G    P
Sbjct: 64  LNKHIWSSGIRSVP 77



 Score = 30.3 bits (65), Expect = 0.74
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 2/33 (6%)
 Frame = +2

Query: 308 NDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 400
           ND+ED+  +L++LVT   VP   +KGL T+ V+
Sbjct: 89  NDEEDAKEELYSLVTVAEVPQEGLKGLGTKLVE 121


>08_02_1181 - 24985963-24986242,24987109-24987197
          Length = 122

 Score =  102 bits (244), Expect = 2e-22
 Identities = 48/73 (65%), Positives = 56/73 (76%), Gaps = 1/73 (1%)
 Frame = +3

Query: 60  ERKGKSAINE-VVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRL 236
           E+KG +A  E VVTREYT+NLHKRLH   FKK+AP AIKEIRKFA+K MGT D+RVD +L
Sbjct: 3   EKKGGAARKEEVVTREYTINLHKRLHSCTFKKKAPNAIKEIRKFAQKAMGTTDVRVDVKL 62

Query: 237 NKFLWSRGSEMFP 275
           NK +WS G    P
Sbjct: 63  NKHIWSSGIRSVP 75



 Score = 31.9 bits (69), Expect = 0.24
 Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 2/33 (6%)
 Frame = +2

Query: 308 NDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 400
           ND+ED+  +L++LVT   VP   +KGL T+ VD
Sbjct: 87  NDEEDAKEELYSLVTVAEVPPEGLKGLGTKVVD 119


>02_05_0532 - 29814199-29814478,29814922-29814969,29815558-29815649
          Length = 139

 Score = 84.6 bits (200), Expect = 3e-17
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 16/80 (20%)
 Frame = +3

Query: 84  NEVVTREYTVNLHKRLHGV----------------GFKKRAPRAIKEIRKFAEKQMGTPD 215
           +EVVTREYT+NLHKRLHG                  FKK+AP AIKEIRKFA+K MGT D
Sbjct: 13  DEVVTREYTINLHKRLHGCIVCSNDLIHYAPDIVSTFKKKAPNAIKEIRKFAQKAMGTTD 72

Query: 216 IRVDTRLNKFLWSRGSEMFP 275
           IR+D +LNK +W+ G    P
Sbjct: 73  IRIDVKLNKAIWTNGIRSVP 92



 Score = 30.7 bits (66), Expect = 0.56
 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 2/33 (6%)
 Frame = +2

Query: 308 NDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 400
           ND+ED+  +L++LVT   +P   +KGL T+ V+
Sbjct: 104 NDEEDAKEELYSLVTVAEIPAEGLKGLGTKVVE 136


>01_06_0668 +
           31058497-31059510,31059609-31059676,31060189-31060270,
           31060339-31060431,31060516-31060668,31060900-31060968,
           31061091-31061184,31061594-31061677,31062133-31062221,
           31062340-31062456,31062567-31062707,31062823-31063005
          Length = 728

 Score = 29.1 bits (62), Expect = 1.7
 Identities = 15/53 (28%), Positives = 26/53 (49%)
 Frame = +3

Query: 111 VNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSRGSEM 269
           +N+   ++G GF   A   + E+ K A KQ+  PD    +  + ++ S  S M
Sbjct: 441 LNVDSAVYGAGFYASATPQLDELLKEASKQVQNPDNETQSLYDLWMASDSSSM 493


>03_02_0001 +
           4844009-4844046,4845155-4845410,4845560-4845704,
           4845747-4845931,4847011-4847268,4847395-4847476,
           4847562-4847641
          Length = 347

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 7/52 (13%)
 Frame = -1

Query: 289 HTDTGGNISDPLDQRN-LFKRVSTRMSGVPI------CFSANFRISLIALGA 155
           +TD  GN++DP  Q N + + +S   SGV +       + A++R  L  LG+
Sbjct: 82  NTDDSGNVADPRLQLNKVVREISYSSSGVTVKTEDGSVYQADYRHGLCQLGS 133


>03_02_0178 + 6195402-6199158,6199438-6200003
          Length = 1440

 Score = 26.6 bits (56), Expect = 9.1
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +3

Query: 24  TKLKITMAKPKGERKGKSAINEVVTREYTVNL 119
           T L + M KP  E KGK    +V+++E  + +
Sbjct: 704 TALNLIMGKPSAEDKGKGIAFDVLSKEEDIGV 735


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,909,514
Number of Sequences: 37544
Number of extensions: 199009
Number of successful extensions: 400
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 394
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 399
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 859680288
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -