SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30117.Seq
         (608 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_01_0158 - 1103461-1104186                                           45   4e-05
08_01_0202 - 1638978-1639571                                           43   2e-04
03_06_0157 - 32039020-32039175,32039267-32039338,32039478-320396...    30   1.6  
04_04_1582 - 34590698-34591199,34593849-34594690                       29   2.9  
03_01_0483 + 3689155-3689814                                           29   3.8  
11_06_0416 + 23307984-23308281,23310083-23310900                       28   5.0  
03_06_0609 - 35042276-35042388,35042476-35042527,35042624-350427...    28   5.0  
08_01_0229 + 1834102-1834358,1834442-1834901                           28   6.7  
05_02_0119 + 6793292-6793613,6795793-6795952,6796416-6796458,679...    28   6.7  
01_01_0569 - 4214513-4214669,4215082-4216031,4216488-4216547           28   6.7  
04_01_0508 + 6647812-6647820,6647864-6648226,6649351-6650673,665...    27   8.8  

>02_01_0158 - 1103461-1104186
          Length = 241

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 1/55 (1%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEPVKG 416
           ED+FVHQ++I  +      RS+ +GE VEFA+   E G  +A  VTGP G  VKG
Sbjct: 30  EDLFVHQSSIKADG----FRSLAEGEQVEFAISESEDGRTKAVDVTGPDGSFVKG 80



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +1

Query: 178 AEKVSGTVKWFNVKSGYGFINRND 249
           A +  GTVKWFN   G+GFI+ +D
Sbjct: 4   AARHRGTVKWFNDTKGFGFISPDD 27


>08_01_0202 - 1638978-1639571
          Length = 197

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 2/67 (2%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEPVK-GSPYA 428
           ED+FVHQ+++  +      RS+ DG+ VEF+V +G  G  +A  VT PGG  +  GS  +
Sbjct: 29  EDLFVHQSSLKSDG----YRSLNDGDVVEFSVGSGNDGRTKAVDVTAPGGGALTGGSRPS 84

Query: 429 ADKRRGY 449
               RGY
Sbjct: 85  GGGDRGY 91



 Score = 35.9 bits (79), Expect = 0.025
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 178 AEKVSGTVKWFNVKSGYGFINRND 249
           +E+V GTVKWF+   G+GFI  +D
Sbjct: 3   SERVKGTVKWFDATKGFGFITPDD 26


>03_06_0157 -
           32039020-32039175,32039267-32039338,32039478-32039602,
           32039678-32040559,32040623-32040692,32041248-32041739,
           32041985-32042044,32042541-32042618,32043322-32044344
          Length = 985

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = +3

Query: 327 GEAVEFAVVAGEKGFEAAGVTGPGGEPVKG 416
           GE+ E  ++ GE   E   V GPGGEP  G
Sbjct: 388 GESKEDEIIEGEPDPEMEVVAGPGGEPKVG 417


>04_04_1582 - 34590698-34591199,34593849-34594690
          Length = 447

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +3

Query: 321 GDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRR 443
           GDG   E +   G+KG    G  G GG   KGS  ++++ R
Sbjct: 229 GDGGVEEGSAGGGKKGGGGGGGGGGGGHGEKGSAKSSEQER 269


>03_01_0483 + 3689155-3689814
          Length = 219

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 18/42 (42%), Positives = 22/42 (52%)
 Frame = +3

Query: 321 GDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRG 446
           GDG A      AG  G +AA   G G +PV+GS   +D  RG
Sbjct: 62  GDGGADPVRGSAG--GSDAARGDGGGADPVRGSAGGSDAARG 101



 Score = 27.9 bits (59), Expect = 6.7
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = +3

Query: 321 GDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRG 446
           GDG   +  V     G +AA   G G +PV+GS   +D  RG
Sbjct: 81  GDGGGAD-PVRGSAGGSDAARGDGGGADPVRGSAGGSDAARG 121


>11_06_0416 + 23307984-23308281,23310083-23310900
          Length = 371

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -3

Query: 477 HLDEGNIGGGSHGACLQHKVSLLLAHH 397
           HLD+ N+ G  +G   + K+SLL A H
Sbjct: 89  HLDDPNVDGVRNGVRARFKISLLAAAH 115


>03_06_0609 -
           35042276-35042388,35042476-35042527,35042624-35042725,
           35043546-35043745,35045258-35045336,35045541-35045595,
           35045947-35046122,35046386-35046988,35047077-35047265,
           35048150-35048201,35048289-35048356,35048873-35048911,
           35048912-35048970,35049639-35049782,35050136-35050238,
           35050368-35050467,35050596-35050612
          Length = 716

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = -1

Query: 392 TSNTSCFKAFLPGNHGKLHRLSVADRAHSLTWVVTGDGSLMHK 264
           T N   ++ FLP   G +  L + D   ++ W ++ + SL HK
Sbjct: 293 TENDCAWQRFLPS--GPIALLPIGDNYSNIVWTMSPEESLRHK 333


>08_01_0229 + 1834102-1834358,1834442-1834901
          Length = 238

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 9/12 (75%), Positives = 11/12 (91%)
 Frame = -3

Query: 75  GVIGERRWWQRW 40
           GV+GERR W+RW
Sbjct: 134 GVVGERRRWRRW 145


>05_02_0119 +
           6793292-6793613,6795793-6795952,6796416-6796458,
           6797015-6797335
          Length = 281

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 13/27 (48%), Positives = 14/27 (51%)
 Frame = +3

Query: 366 GFEAAGVTGPGGEPVKGSPYAADKRRG 446
           G EA G +GPGGE         D RRG
Sbjct: 75  GVEAPGGSGPGGERTMAPANIDDSRRG 101


>01_01_0569 - 4214513-4214669,4215082-4216031,4216488-4216547
          Length = 388

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 17/38 (44%), Positives = 17/38 (44%)
 Frame = +3

Query: 309 VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSP 422
           VR  G G A  FAV     G  A    G GGEP   SP
Sbjct: 53  VRGGGGGGAALFAVPRLFVGLAAKRGAGDGGEPASRSP 90


>04_01_0508 + 6647812-6647820,6647864-6648226,6649351-6650673,
            6653569-6653766,6654485-6654568,6655175-6655920,
            6656480-6657341
          Length = 1194

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 12/33 (36%), Positives = 22/33 (66%)
 Frame = -3

Query: 504  VELLHRLVRHLDEGNIGGGSHGACLQHKVSLLL 406
            ++L+ RLVR L     GG +  A ++HK++L++
Sbjct: 951  IKLVDRLVRVLSPEGSGGSTRYAGMRHKLTLVI 983


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,387,859
Number of Sequences: 37544
Number of extensions: 242433
Number of successful extensions: 960
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 925
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 958
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1454766756
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -