SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30115.Seq
         (690 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0364 - 2834446-2834742,2834838-2835197,2835281-2835562,283...   118   4e-27
10_08_0170 + 15397381-15397418,15397519-15397681,15398419-153986...   113   9e-26
08_02_0657 - 19749835-19751942,19753123-19753561                       98   7e-21
10_08_0548 - 18685114-18685230,18685615-18685724,18685779-186858...    29   2.6  
06_01_0057 - 483710-484309                                             29   3.5  
10_07_0117 + 13028336-13028404,13029073-13029174,13031108-130313...    28   8.0  

>03_01_0364 -
           2834446-2834742,2834838-2835197,2835281-2835562,
           2835634-2835705,2835798-2836019,2836105-2836871,
           2837206-2837434,2838027-2838189,2838313-2838350
          Length = 809

 Score =  118 bits (284), Expect = 4e-27
 Identities = 53/99 (53%), Positives = 68/99 (68%)
 Frame = +2

Query: 215 LAQGQTPQGNRLHLLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 394
           L +G+  +     +L+DD C + KIRM             DVVS+  CP VKYGKRVHIL
Sbjct: 65  LLKGKKRKDTICIVLADDTCEEPKIRMNKVVRKNLRVRLGDVVSVHQCPDVKYGKRVHIL 124

Query: 395 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFMVRG 511
           PIDD+VEG+TGNLF+ +LKPYF+EAYRP+ + D F+VRG
Sbjct: 125 PIDDTVEGITGNLFDAFLKPYFLEAYRPLRKGDLFLVRG 163



 Score = 95.5 bits (227), Expect = 4e-20
 Identities = 42/57 (73%), Positives = 50/57 (87%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMR+VEFKV+ETDP+ +CIVAPDT I CDGEPIKRE+EE  L+ VGYDD+GG RKQ+
Sbjct: 164 GMRSVEFKVIETDPAEYCIVAPDTEIFCDGEPIKREDEER-LDEVGYDDVGGVRKQM 219



 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 43/67 (64%), Positives = 53/67 (79%)
 Frame = +3

Query: 54  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 233
           +D K   D STAIL RK  PNRL+V+EA +DDNSV+ +    ME+LQLFRGDTVLLKGK+
Sbjct: 11  SDPKGKKDFSTAILERKKSPNRLVVDEATNDDNSVIGMHPDTMEKLQLFRGDTVLLKGKK 70

Query: 234 RKETVCI 254
           RK+T+CI
Sbjct: 71  RKDTICI 77


>10_08_0170 +
           15397381-15397418,15397519-15397681,15398419-15398647,
           15398777-15399543,15399650-15399871,15399961-15400032,
           15400100-15400408,15400491-15400850,15401199-15401492
          Length = 817

 Score =  113 bits (273), Expect = 9e-26
 Identities = 51/99 (51%), Positives = 67/99 (67%)
 Frame = +2

Query: 215 LAQGQTPQGNRLHLLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 394
           L +G+  +     +L+D+ C + KIRM             DVVS+  C  VKYGKRVHIL
Sbjct: 65  LLKGKKRKDTICIVLADETCEEPKIRMNKVVRKNLRVRLGDVVSVHQCQDVKYGKRVHIL 124

Query: 395 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFMVRG 511
           PIDD+VEG+TGNLF+ +LKPYF+EAYRP+ + D F+VRG
Sbjct: 125 PIDDTVEGITGNLFDAFLKPYFLEAYRPVRKGDLFLVRG 163



 Score = 98.3 bits (234), Expect = 5e-21
 Identities = 47/67 (70%), Positives = 54/67 (80%)
 Frame = +3

Query: 54  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 233
           AD K   D STAIL RK  PNRL+V+EA +DDNSVVAL    ME+LQLFRGDTVLLKGK+
Sbjct: 11  ADPKGKKDYSTAILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKK 70

Query: 234 RKETVCI 254
           RK+T+CI
Sbjct: 71  RKDTICI 77



 Score = 95.5 bits (227), Expect = 4e-20
 Identities = 42/57 (73%), Positives = 50/57 (87%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMR+VEFKV+ETDP+ +CIVAPDT I CDGEPIKRE+EE  L+ VGYDD+GG RKQ+
Sbjct: 164 GMRSVEFKVIETDPTEYCIVAPDTEIFCDGEPIKREDEER-LDEVGYDDVGGVRKQM 219


>08_02_0657 - 19749835-19751942,19753123-19753561
          Length = 848

 Score = 97.9 bits (233), Expect = 7e-21
 Identities = 39/83 (46%), Positives = 58/83 (69%)
 Frame = +2

Query: 263 DDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNLFEV 442
           D++CPD ++R+             D+V++ PCP+++  KRV + P DDSVEG++G+LFE 
Sbjct: 84  DESCPDGRLRLSRGVRSNLHVRLGDLVTVKPCPTIRNAKRVQLRPFDDSVEGISGDLFEP 143

Query: 443 YLKPYFMEAYRPIHRDDTFMVRG 511
           YLKPYFM+A RP+ + D F+VRG
Sbjct: 144 YLKPYFMDALRPVKKGDRFLVRG 166



 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 35/58 (60%), Positives = 44/58 (75%), Gaps = 2/58 (3%)
 Frame = +1

Query: 514 MRAVEFKVVETDPSPF-CIVAPDTVIHCD-GEPIKREEEEEALNAVGYDDIGGCRKQL 681
           M AVEFKV++T+P+    IVA DT I CD G+P+KRE+EE  L+  GYDD+GG RKQL
Sbjct: 168 MHAVEFKVMDTEPNNEPVIVAGDTEIFCDEGDPVKREDEER-LDGPGYDDVGGVRKQL 224



 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 35/64 (54%), Positives = 46/64 (71%), Gaps = 5/64 (7%)
 Frame = +3

Query: 75  DLSTAILR--RKDRPNRLIVEEA---VSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRK 239
           D STAIL   +K  PNRL+ ++A   V+ DNS V LS+A ME+L +FRGD V L+G+RR+
Sbjct: 16  DYSTAILECAKKKSPNRLMADDAEGGVAVDNSTVTLSEATMEELGIFRGDLVTLRGRRRR 75

Query: 240 ETVC 251
           E VC
Sbjct: 76  EAVC 79


>10_08_0548 -
           18685114-18685230,18685615-18685724,18685779-18685802,
           18686135-18686213,18686346-18686588,18686659-18686823,
           18686960-18687037,18687185-18687231,18687319-18687379,
           18687667-18687723,18688164-18688247,18689292-18689357,
           18689447-18689574,18689693-18689885
          Length = 483

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 9/18 (50%), Positives = 15/18 (83%)
 Frame = -1

Query: 534 FELDGAHAPRTMKVSSRW 481
           F LDGAH+P +M++ ++W
Sbjct: 331 FYLDGAHSPESMEICAKW 348


>06_01_0057 - 483710-484309
          Length = 199

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 1/50 (2%)
 Frame = +1

Query: 79  YRPRSSVARTDPTVSLSKKQSAMTTQS-WHFHRPKWSNFNSSVVTQSCSR 225
           Y P    ART P  ++   + A    S W F    WS+  S V+T+  SR
Sbjct: 62  YFPLGPAARTSPAGTVLCFEDARGGDSTWRFRYSYWSSSQSYVITKGWSR 111


>10_07_0117 +
           13028336-13028404,13029073-13029174,13031108-13031367,
           13031813-13031882,13031935-13031966,13032736-13032823,
           13033431-13033742,13033822-13033896,13034018-13034559,
           13034936-13035044,13035713-13035892,13036243-13036404
          Length = 666

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +2

Query: 371 YGKRVHILPIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFMVRGACAPSSSKWSKQ 547
           Y  R+ +  +D+ +     +   V L   FM++Y PI      +VRG   PS++K S Q
Sbjct: 213 YSSRIAVSAVDNIIMVHQIDAKVVILYDVFMDSYAPISAPLPLLVRG--LPSNNKQSAQ 269


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,279,782
Number of Sequences: 37544
Number of extensions: 412189
Number of successful extensions: 1106
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1067
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1102
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1756684372
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -