SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30112.Seq
         (446 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_0831 - 21810002-21810319,21810423-21810573,21810660-218108...    31   0.42 
04_03_0923 + 20843477-20845044,20846081-20846996                       30   0.97 
04_03_0772 - 19438910-19439209,19439692-19439828,19441334-194415...    28   3.0  
06_01_0244 - 1844161-1844241,1844356-1844394,1844510-1844617,184...    28   3.9  
04_03_0914 + 20788103-20789642,20790036-20790529                       27   5.2  
07_01_1132 + 10531922-10532136,10532307-10532433,10532945-105331...    27   6.9  
06_03_0765 + 24421982-24422120,24422287-24422367,24422722-244229...    27   6.9  
01_02_0099 + 11092529-11093140,11094153-11094424,11095378-110954...    27   6.9  
12_02_0417 - 18896949-18897269,18897340-18897424,18899561-188996...    27   9.1  
11_06_0277 + 21843658-21845220,21846533-21846718,21847037-218471...    27   9.1  
04_04_0114 + 22861300-22861476,22864952-22864969,22865187-22867163     27   9.1  

>07_03_0831 -
           21810002-21810319,21810423-21810573,21810660-21810897,
           21811011-21811221,21811336-21811559,21811696-21811806,
           21813265-21813636,21813810-21814782
          Length = 865

 Score = 31.1 bits (67), Expect = 0.42
 Identities = 13/43 (30%), Positives = 21/43 (48%)
 Frame = -1

Query: 236 HSVTAFDSVFLLLRTESSSGSDIRWTVLSHSTQTTFPAARILL 108
           H++T  D   L++    ++G+D+ W    H T T  P   I L
Sbjct: 129 HTLTIRDDGNLVISGSDAAGTDVEWESFHHPTDTFVPGMEIAL 171


>04_03_0923 + 20843477-20845044,20846081-20846996
          Length = 827

 Score = 29.9 bits (64), Expect = 0.97
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 7/61 (11%)
 Frame = -1

Query: 275 ILRRASDSGLXYGHS-VTAFDSVFLLLRT------ESSSGSDIRWTVLSHSTQTTFPAAR 117
           IL  A+ S +   H+ +TA D++ +LL         SS+ S I W    + T T FP+A+
Sbjct: 108 ILDHATKSIIWSTHANITAKDTIAILLNNGNLVLRSSSNSSIIFWQSFDYPTDTLFPSAK 167

Query: 116 I 114
           I
Sbjct: 168 I 168


>04_03_0772 -
           19438910-19439209,19439692-19439828,19441334-19441570,
           19441948-19442149,19442761-19442858,19443082-19443665,
           19443725-19443882
          Length = 571

 Score = 28.3 bits (60), Expect = 3.0
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +3

Query: 45  AMCILVYGNSEDDFCEIDSIEQEDPC 122
           A C+ V G S DD CE  ++  +D C
Sbjct: 83  AACLGVIGGSGDDLCEKAAVRYDDRC 108


>06_01_0244 -
           1844161-1844241,1844356-1844394,1844510-1844617,
           1844638-1844685,1845058-1845111,1845214-1845268,
           1845442-1845522,1846238-1846615,1847196-1847401
          Length = 349

 Score = 27.9 bits (59), Expect = 3.9
 Identities = 16/36 (44%), Positives = 18/36 (50%)
 Frame = -2

Query: 220 SIPSFCCLGQSPVLALISDGQSSATVHKPPSLRHGS 113
           ++PS CCL  SP         S   VHKPP  R GS
Sbjct: 125 AVPSGCCLSSSP--------GSVIWVHKPPEGRRGS 152


>04_03_0914 + 20788103-20789642,20790036-20790529
          Length = 677

 Score = 27.5 bits (58), Expect = 5.2
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = -1

Query: 203 LLRTESSSGSDIRWTVLSHSTQTTFPAARI 114
           L+ T  S+ S++ W    + T T FP A++
Sbjct: 136 LILTNPSNSSEVLWQSFDYPTDTLFPRAKL 165


>07_01_1132 +
           10531922-10532136,10532307-10532433,10532945-10533100,
           10533755-10533847,10534010-10534090,10534205-10534276,
           10534608-10534676,10534764-10534874,10535039-10535089
          Length = 324

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 19/83 (22%), Positives = 34/83 (40%)
 Frame = -2

Query: 280 ETFSAVLPTLVSXTDTP*QHSIPSFCCLGQSPVLALISDGQSSATVHKPPSLRHGSSCSM 101
           ++FS+  P L    D      IP  C + Q P   +  D        KP  +      ++
Sbjct: 139 QSFSSSFPHLFHDNDDHLPCLIP--CAIDQDPYFRMTCDVAPKLGFQKPSLIESRFFPAL 196

Query: 100 ESISQKSSSLFP*TKMHIAQNNK 32
           +  S K S+  P + +++  N+K
Sbjct: 197 QGESTKMSASDPNSAIYVTDNSK 219


>06_03_0765 +
           24421982-24422120,24422287-24422367,24422722-24422962,
           24423078-24423171,24423513-24423729,24423818-24423909,
           24424303-24424638
          Length = 399

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +1

Query: 205 KKTESNAVTECPXKRPESEARRRMFLERLLQSIFDI*RSFRLSR 336
           K+T     +ECP + P+S    +   +R +  IFD+ R  + +R
Sbjct: 172 KRTAKPRGSECPEQLPDSSNAAKTDTDRNMSVIFDVLRKKKNAR 215


>01_02_0099 +
           11092529-11093140,11094153-11094424,11095378-11095438,
           11095553-11095622,11095645-11095901,11096466-11096639
          Length = 481

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +3

Query: 99  SIEQEDPCRREGGLCTVAEDCPSD 170
           S+E+ED C R GG   VA DC  D
Sbjct: 439 SMEKEDGCSRVGG--AVASDCVED 460


>12_02_0417 -
           18896949-18897269,18897340-18897424,18899561-18899656,
           18900418-18900476,18901285-18901359
          Length = 211

 Score = 26.6 bits (56), Expect = 9.1
 Identities = 12/39 (30%), Positives = 19/39 (48%)
 Frame = -2

Query: 181 LALISDGQSSATVHKPPSLRHGSSCSMESISQKSSSLFP 65
           LA I+D Q   T+ +P  + HG+S  +         +FP
Sbjct: 89  LAAIADTQPQTTISRPQMVPHGASPGLGGQYMSQVPMFP 127


>11_06_0277 +
           21843658-21845220,21846533-21846718,21847037-21847165,
           21847256-21847415,21847846-21847955,21848038-21848247,
           21848473-21848730,21848810-21848885,21849217-21849350,
           21849928-21850007,21850265-21850316
          Length = 985

 Score = 26.6 bits (56), Expect = 9.1
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
 Frame = +3

Query: 39  FCAMCILVYGN-SEDDFCEIDSIEQE 113
           FC + +L  G    DD CE++SI+ E
Sbjct: 565 FCCLKLLASGKLGNDDLCEVNSIDVE 590


>04_04_0114 + 22861300-22861476,22864952-22864969,22865187-22867163
          Length = 723

 Score = 26.6 bits (56), Expect = 9.1
 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 2/40 (5%)
 Frame = +3

Query: 81  DFCEIDSIEQEDPCRREGG--LCTVAEDCPSDIRARTGLC 194
           D C   +    D C+  GG   CT    C    R R+GLC
Sbjct: 562 DNCSKSAQGSTDFCKAHGGGKRCTWGTGCEKFARGRSGLC 601


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,592,365
Number of Sequences: 37544
Number of extensions: 216405
Number of successful extensions: 709
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 687
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 708
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 859680288
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -