SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30111.Seq
         (593 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0729 + 27612106-27612195,27612284-27612370,27612469-276125...   104   8e-28
03_05_0339 + 23287620-23287676,23287784-23287849,23287937-232880...    89   2e-18
05_07_0067 + 27463703-27463705,27464309-27464365,27464779-274648...    79   2e-15
06_03_1193 - 28298656-28298754,28299303-28299377,28299456-282995...    79   3e-15
06_03_0353 + 19810945-19810975,19811308-19811369,19811741-198118...    75   4e-14
03_06_0362 + 33379489-33379624,33380161-33380423,33380524-333806...    73   1e-13
02_02_0253 - 8325437-8325628,8325705-8325779,8325933-8326037,832...    73   2e-13
06_03_0477 - 21250811-21250981,21251261-21251374,21251447-212516...    68   5e-12
10_08_0620 - 19321612-19323237                                         60   2e-09
02_02_0739 - 13560241-13560622,13561192-13561239,13563727-13564949     59   3e-09
05_01_0337 - 2658647-2658722,2658797-2658915,2658995-2659102,265...    55   4e-08
02_01_0024 + 159595-159801,159892-160017,160201-160338,160431-16...    37   0.011
09_06_0292 + 22075647-22075691,22077394-22077507,22077602-220778...    36   0.018
06_01_0097 - 810283-810296,810398-810521,810974-811066,811144-81...    36   0.024
03_06_0760 - 36067752-36068045,36068260-36068711,36069263-360695...    35   0.056
12_01_1011 + 10292709-10292765,10293003-10293156,10294062-102941...    34   0.098
04_01_0006 - 112476-114182,114627-114676,115289-115463                 28   4.9  
03_03_0113 + 14550435-14550822,14550831-14551660,14552105-145522...    28   4.9  
05_03_0388 + 13401985-13402117,13404122-13404173,13405867-134059...    28   6.5  
12_01_0559 + 4527769-4527924,4528038-4528129,4528799-4528905,452...    27   8.5  
03_01_0305 - 2383187-2383298,2383606-2383684,2383762-2383867,238...    27   8.5  

>04_04_0729 +
           27612106-27612195,27612284-27612370,27612469-27612528,
           27612554-27612688,27612769-27612864,27613149-27613214,
           27613647-27613864,27614093-27614189,27614605-27614691,
           27614892-27615026,27615121-27615225,27615717-27615845,
           27615925-27616028,27616598-27616688,27616774-27616857
          Length = 527

 Score =  104 bits (250), Expect(2) = 8e-28
 Identities = 50/62 (80%), Positives = 57/62 (91%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EVEHPAAKVLVELA+LQD EVGDGTTSVVIIAAELLK  ++LV+ KIHPTSIISGY
Sbjct: 19  LRMLEVEHPAAKVLVELAELQDREVGDGTTSVVIIAAELLKRGNDLVRNKIHPTSIISGY 78

Query: 425 RL 430
           RL
Sbjct: 79  RL 80



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 18/21 (85%), Positives = 21/21 (100%)
 Frame = +3

Query: 192 MLVDDIGDVTVTNEGATILKM 254
           MLVDDIGDVT+TN+GATIL+M
Sbjct: 1   MLVDDIGDVTITNDGATILRM 21



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 18/26 (69%), Positives = 23/26 (88%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDAAQ 591
           AKT+MSSKLI +D+DFF+ +VVDA Q
Sbjct: 137 AKTSMSSKLINSDSDFFANLVVDAVQ 162



 Score = 36.7 bits (81), Expect(2) = 8e-28
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = +2

Query: 422 YRLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           Y+LA +EA KY+++ L V V+ LG+ SLI   K
Sbjct: 106 YQLAMREACKYVEEKLAVKVDKLGKDSLINCAK 138


>03_05_0339 +
           23287620-23287676,23287784-23287849,23287937-23288048,
           23288240-23288368,23288795-23288866,23289245-23289360,
           23289494-23289570,23289788-23290273,23290373-23290688,
           23290769-23290915
          Length = 525

 Score = 89.0 bits (211), Expect = 2e-18
 Identities = 37/63 (58%), Positives = 57/63 (90%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ +++PAAKVLV+++++QD+EVGDGTTSVV++A ELL+ A++LV  KIHP +II+GY
Sbjct: 64  LKSLHIDNPAAKVLVDISKVQDDEVGDGTTSVVVLAGELLREAEKLVNMKIHPMTIIAGY 123

Query: 425 RLA 433
           R+A
Sbjct: 124 RMA 126



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 3/53 (5%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIG---DVTVTNEGATILK 251
           G+  R    +      ++VK++LGP G+DK+L    G    VTVTN+GATILK
Sbjct: 14  GERARMAAFIGAMAIADLVKTTLGPKGMDKIL-QSTGRGRSVTVTNDGATILK 65



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A TT+SSK++  D ++F+E+ VDA
Sbjct: 156 AMTTLSSKILSQDKEYFAELAVDA 179


>05_07_0067 +
           27463703-27463705,27464309-27464365,27464779-27464844,
           27464985-27465096,27465281-27465409,27466076-27466191,
           27466364-27466440,27466678-27467163,27467255-27467570,
           27467618-27467797
          Length = 513

 Score = 79.4 bits (187), Expect = 2e-15
 Identities = 33/58 (56%), Positives = 52/58 (89%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIIS 418
           +K++ +++PAAKVLV+++++QD+EVGDGTTSVV++A ELL+ A++LV  KIHP +II+
Sbjct: 65  LKSLHIDNPAAKVLVDISKVQDDEVGDGTTSVVVLAGELLREAEKLVNMKIHPMTIIA 122



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 3/57 (5%)
 Frame = +3

Query: 90  TRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIG---DVTVTNEGATILK 251
           T   G+  R  + +      ++VK++LGP G+DK+L    G    VTVTN+GATILK
Sbjct: 11  TEEKGERARMASFVGGMAISDLVKTTLGPKGMDKIL-QSTGRGRSVTVTNDGATILK 66



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A TT+SSK++  D ++F+ + VDA
Sbjct: 133 AMTTLSSKILSQDKEYFAGLAVDA 156


>06_03_1193 -
           28298656-28298754,28299303-28299377,28299456-28299544,
           28299679-28299760,28300385-28300474,28300557-28300655,
           28300733-28300852,28300968-28301084,28301174-28301309,
           28301415-28301584,28301744-28301947,28302032-28302157,
           28302841-28303101,28303215-28303229
          Length = 560

 Score = 78.6 bits (185), Expect = 3e-15
 Identities = 36/77 (46%), Positives = 56/77 (72%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           +++ HPAAK+LV++A+ QD EVGDGTT+VV++AAE LK A   ++  +HP S+I  YR A
Sbjct: 72  LDIIHPAAKILVDIAKSQDSEVGDGTTTVVLLAAEFLKEAKPYIEDGVHPHSLIRSYRTA 131

Query: 434 CKEAVKYIQDNLTVTVE 484
              A++ ++D L  ++E
Sbjct: 132 GHLAIEKVKD-LATSIE 147



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 17/44 (38%), Positives = 31/44 (70%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           N+       + V+++LGP G+DK++ DD G  T++N+GATI+++
Sbjct: 28  NINACTVVADTVRTTLGPRGMDKLIHDDKGGTTISNDGATIMRL 71



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A TT+SSKLIG + +FF+ MVVDA
Sbjct: 162 AATTLSSKLIGGEKEFFASMVVDA 185


>06_03_0353 +
           19810945-19810975,19811308-19811369,19811741-19811813,
           19813292-19813359,19813496-19813565,19813908-19813976,
           19814065-19814136,19814247-19814320,19814420-19814697,
           19814804-19815188,19815268-19815393,19815583-19815687,
           19815986-19815994,19817040-19817114,19817202-19817390
          Length = 561

 Score = 74.9 bits (176), Expect = 4e-14
 Identities = 33/88 (37%), Positives = 58/88 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +++ HPAAK ++EL++ QDEEVGDGTTSV+++A E+L  A+  +    HPT I   Y
Sbjct: 67  LREIDIAHPAAKSMIELSRTQDEEVGDGTTSVIVLAGEMLHVAEAFIDKHYHPTVICRAY 126

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
             A ++A+  + D + + V+   R +++
Sbjct: 127 TKALEDALA-VLDKIAMHVDVNDRAAML 153



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           R  G  V   N+       +I++++LGP  + KML+D  G + VTN+G  IL+
Sbjct: 16  RESGTKVHHANIQAAKAVADIIRTTLGPRSMLKMLLDASGGIVVTNDGNAILR 68


>03_06_0362 +
           33379489-33379624,33380161-33380423,33380524-33380670,
           33380753-33380914,33381681-33381758,33382329-33382462,
           33382702-33382774,33382852-33382929,33383002-33383124,
           33383223-33383317,33383723-33383932,33384115-33384172,
           33384268-33384333
          Length = 540

 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  +EV+HPAAK+LV   + Q EE+GDG    +  A ELL+ A+EL++  +HP+ II GY
Sbjct: 68  VNELEVQHPAAKILVLAGRAQQEEIGDGANLTISFAGELLEKAEELIRMGLHPSEIIIGY 127

Query: 425 RLACKEAVKYIQD 463
             A  + V+ ++D
Sbjct: 128 TKAINKTVEILED 140



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 14/32 (43%), Positives = 25/32 (78%)
 Frame = +3

Query: 153 IVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           I ++SLGP G++KM+++ +  + VTN+ ATI+
Sbjct: 37  ITRTSLGPNGMNKMVINHLDKLFVTNDAATIV 68


>02_02_0253 -
           8325437-8325628,8325705-8325779,8325933-8326037,
           8326249-8326374,8326451-8326835,8326931-8327208,
           8327294-8327367,8327476-8327547,8327637-8327705,
           8340132-8340201,8340806-8340873,8341571-8341643,
           8341807-8341868,8342168-8342198
          Length = 559

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 33/88 (37%), Positives = 56/88 (63%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +++ HPAAK ++EL++ QDEEVGDGTTSV+++A E+L  A   +    HPT I   Y
Sbjct: 67  LRELDLAHPAAKSMIELSRTQDEEVGDGTTSVIVLAGEMLHVAQAFIDKNYHPTVICRAY 126

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
             A  +A+  + D + + V+   R +++
Sbjct: 127 TKALDDALS-VLDKIAIPVDVDDRVAML 153



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           R  G  V   N+       +I++++LGP  + KML+D  G + VTN+G  IL+
Sbjct: 16  RESGTKVHHANIQAAKAVADIIRTTLGPQSMLKMLLDAAGGIVVTNDGNCILR 68


>06_03_0477 -
           21250811-21250981,21251261-21251374,21251447-21251613,
           21252051-21252153,21252315-21252367,21252438-21252570,
           21252835-21253183,21253685-21254003,21254519-21254717
          Length = 535

 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 30/72 (41%), Positives = 51/72 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V++  AK++VEL+  QD E+GDGTT VV++A  LL+ A++L++  IHP  I  GY
Sbjct: 74  LEQMDVDNQIAKLMVELSCSQDYEIGDGTTGVVVMAGSLLEQAEKLLERGIHPIRIAEGY 133

Query: 425 RLACKEAVKYIQ 460
            LA + A  +++
Sbjct: 134 ELASRIAFDHLE 145



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 24/54 (44%), Positives = 34/54 (62%)
 Frame = +3

Query: 90  TRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +R  G   +  N+        I+++SLGP G+DKML    GDVT+TN+GATIL+
Sbjct: 22  SRLRGLDAQKANIAAGKAVARILRTSLGPKGMDKMLQSPDGDVTITNDGATILE 75


>10_08_0620 - 19321612-19323237
          Length = 541

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 29/80 (36%), Positives = 46/80 (57%)
 Frame = +2

Query: 269 PAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAV 448
           PAA++L +L++ QD   GDGTT+VV++A  LL+ A  L+    HPT+      L    AV
Sbjct: 84  PAARMLADLSRSQDAAAGDGTTTVVVLAGSLLRRAQSLLSAGAHPTAAADALHLLAARAV 143

Query: 449 KYIQDNLTVTVESLGRPSLI 508
           + +   + + VE   R +L+
Sbjct: 144 EVLH-GMAIPVELSDRDALV 162



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 4/52 (7%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDI--GD--VTVTNEGATIL 248
           D VR  N+          ++SLGP G+DKM+      GD  V +TN+GATIL
Sbjct: 25  DDVRGLNIAAGRAVAAAARTSLGPRGMDKMISSSSSGGDQAVIITNDGATIL 76


>02_02_0739 - 13560241-13560622,13561192-13561239,13563727-13564949
          Length = 550

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 29/88 (32%), Positives = 48/88 (54%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  + +  PAA++L EL++ QD   GDGTT+VV++A  LL+ A  L+    HPT+     
Sbjct: 72  LSRMSLLQPAARMLAELSRSQDAAAGDGTTTVVVLAGSLLRRAQSLLSAGAHPTAAADAL 131

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
                 AV+ +   + + +E   R SL+
Sbjct: 132 HRLATRAVEVLH-AMAIPIELSDRDSLV 158



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 24/58 (41%), Positives = 35/58 (60%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKMWKWSILLP 278
           D VR  N+       + V++SLGP G+DKM+     +V +TN+GATIL   + S+L P
Sbjct: 25  DDVRGLNIAAARAVADAVRTSLGPRGMDKMISSGEQEVIITNDGATILS--RMSLLQP 80


>05_01_0337 -
           2658647-2658722,2658797-2658915,2658995-2659102,
           2659187-2659255,2659561-2659655,2659740-2659944,
           2660125-2660211,2660291-2660405,2660696-2660802,
           2661054-2661146,2661243-2661290,2661345-2661544,
           2661993-2662128,2662228-2662291,2662779-2662912
          Length = 551

 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 22/79 (27%), Positives = 46/79 (58%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++++P A ++   A  QD+  GDGTTS V+   EL+K ++  +    HP  ++ G+
Sbjct: 63  LKEMQIQNPTAIMIARTAVAQDDTSGDGTTSTVLFIGELMKQSERCIDEGTHPRFLVDGF 122

Query: 425 RLACKEAVKYIQDNLTVTV 481
            +A +  +++++   T  V
Sbjct: 123 DVAKRATLEFLEKFKTSVV 141



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           N+       +++K++LGP G  KMLV   GD+ +T +G T+LK
Sbjct: 22  NINAAKGLQDVLKTNLGPKGTIKMLVGGAGDIKLTKDGNTLLK 64


>02_01_0024 +
           159595-159801,159892-160017,160201-160338,160431-160526,
           160958-161200,161249-161537,161612-161781,161975-162052,
           162156-162227,162345-162449,162555-162647,162737-162829,
           163109-163235,163317-163330
          Length = 616

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 4/75 (5%)
 Frame = +2

Query: 248 KNVEVEHPA----AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSII 415
           K VE+E P     AK++ + A   ++  GDGTT+ V++A  ++    ++V    +P  I 
Sbjct: 110 KEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGMITEGVKVVAAGANPVQIT 169

Query: 416 SGYRLACKEAVKYIQ 460
            G     K  V  +Q
Sbjct: 170 RGIEKTAKALVSELQ 184


>09_06_0292 +
           22075647-22075691,22077394-22077507,22077602-22077841,
           22077926-22078003,22078094-22078162,22078420-22078545,
           22079108-22079188,22079272-22079460,22079597-22080434,
           22082290-22082411,22082482-22082701,22082910-22083055,
           22083260-22083566,22083886-22084136,22084294-22084533,
           22084930-22085238
          Length = 1124

 Score = 36.3 bits (80), Expect = 0.018
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 4/67 (5%)
 Frame = +2

Query: 260 VEHPAAKVLVE----LAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYR 427
           VEH  A +L E    +A   +  VGDGTT+ +I+A E++      V T  +P ++  G  
Sbjct: 624 VEHAGAMLLQEHVNQIASKTNSSVGDGTTTAIILAREIINLGLLAVATGANPVALRKGID 683

Query: 428 LACKEAV 448
            A  E +
Sbjct: 684 KAVHELI 690


>06_01_0097 -
           810283-810296,810398-810521,810974-811066,811144-811236,
           811410-811514,811661-811732,811857-811934,812210-812379,
           812507-812741,812832-813074,813243-813338,813445-813582,
           814014-814139,814235-814453
          Length = 601

 Score = 35.9 bits (79), Expect = 0.024
 Identities = 19/67 (28%), Positives = 35/67 (52%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           VE+  AK++ + A   ++  GDGTT+ V++A  L+    ++V    +P  I  G     K
Sbjct: 122 VENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVQITRGIEKTAK 181

Query: 440 EAVKYIQ 460
             V+ ++
Sbjct: 182 ALVEELK 188


>03_06_0760 -
           36067752-36068045,36068260-36068711,36069263-36069569,
           36069719-36069864,36069989-36070196,36070339-36070460,
           36070621-36070789,36070875-36070931
          Length = 584

 Score = 34.7 bits (76), Expect = 0.056
 Identities = 17/54 (31%), Positives = 31/54 (57%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISG 421
           +E+  A ++ E+A   ++  GDGTT+  ++A E++K     V +  +P SI  G
Sbjct: 106 MENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSIKKG 159


>12_01_1011 +
           10292709-10292765,10293003-10293156,10294062-10294183,
           10294288-10294495,10294644-10294789,10294920-10295226,
           10295666-10296117,10296388-10296678
          Length = 578

 Score = 33.9 bits (74), Expect = 0.098
 Identities = 16/54 (29%), Positives = 31/54 (57%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISG 421
           +E+  A ++ E+A   ++  GDGTT+  ++A E++K     V +  +P S+  G
Sbjct: 101 MENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKKG 154


>04_01_0006 - 112476-114182,114627-114676,115289-115463
          Length = 643

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = -1

Query: 122 LCSHWVSAGSCPCYRQRCSYSRHF 51
           +CSH V  G+   +   CS+S HF
Sbjct: 80  VCSHGVKTGAAAVFTAECSHSFHF 103


>03_03_0113 +
           14550435-14550822,14550831-14551660,14552105-14552278,
           14552350-14552517
          Length = 519

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = +2

Query: 350 AAELLKNADELVKTKIHPTSIISGYRLACK 439
           AAEL  +  E + +++ P SI++G R ACK
Sbjct: 6   AAELPDDIVEKIISRLPPRSIVTGCRAACK 35


>05_03_0388 +
           13401985-13402117,13404122-13404173,13405867-13405982,
           13406080-13406247,13407047-13407255
          Length = 225

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 14/44 (31%), Positives = 20/44 (45%)
 Frame = +2

Query: 401 PTSIISGYRLACKEAVKYIQDNLTVTVESLGRPSLITQPKQPCH 532
           P+       L+C   VK+ +DNL     +      IT+PK P H
Sbjct: 51  PSDYYGTITLSCSRRVKWNEDNLYEIESNKPVRQKITEPKTPYH 94


>12_01_0559 +
           4527769-4527924,4528038-4528129,4528799-4528905,
           4528987-4529042,4529196-4529346,4530223-4530528,
           4530753-4531597
          Length = 570

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +2

Query: 125 CNGSSGYSKHSKELPWASWS 184
           C G  G S   K +PW+SW+
Sbjct: 13  CGGGGGLSTGRKLVPWSSWA 32


>03_01_0305 -
           2383187-2383298,2383606-2383684,2383762-2383867,
           2383941-2384044,2384141-2384240,2384533-2384628,
           2384724-2384801,2385355-2385423,2385511-2385591,
           2385670-2385759,2385859-2385945,2386022-2386126,
           2386591-2386686,2386796-2386971,2387225-2387384,
           2387898-2388029,2388236-2388260,2389023-2389174
          Length = 615

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 13/63 (20%), Positives = 29/63 (46%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           V++  A ++ ++A   ++  GDGTT   ++   +     + V   ++   +  G  +A  
Sbjct: 135 VKNVGASLVKQVANATNDTAGDGTTCATVLTKAIFAEGCKSVAAGMNAMDLRRGISMAVD 194

Query: 440 EAV 448
           E V
Sbjct: 195 EVV 197


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,525,948
Number of Sequences: 37544
Number of extensions: 298326
Number of successful extensions: 747
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 715
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 744
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1411925004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -