SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30110.Seq
         (444 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_02_0140 + 12255418-12255512,12257514-12257793                      102   1e-22
08_02_1181 - 24985963-24986242,24987109-24987197                      100   1e-21
02_05_0532 - 29814199-29814478,29814922-29814969,29815558-29815649     81   3e-16
01_06_0668 + 31058497-31059510,31059609-31059676,31060189-310602...    29   1.3  
03_02_0178 + 6195402-6199158,6199438-6200003                           27   9.0  

>06_02_0140 + 12255418-12255512,12257514-12257793
          Length = 124

 Score =  102 bits (245), Expect = 1e-22
 Identities = 47/74 (63%), Positives = 56/74 (75%)
 Frame = +2

Query: 50  KGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTR 229
           K +R G +  +EVVTREYT+NLHKRLHG  FKK+AP AIKEIRKFA+K MGT D+RVD +
Sbjct: 4   KKQRPGGARKDEVVTREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTIDVRVDVK 63

Query: 230 LNKFLWSKESEMFP 271
           LNK +WS      P
Sbjct: 64  LNKHIWSSGIRSVP 77



 Score = 35.5 bits (78), Expect = 0.019
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 396
           G+R+VP           ND+ED+  +L++LVT   VP   +KGL T+ V+
Sbjct: 72  GIRSVPRRVRVRIARRRNDEEDAKEELYSLVTVAEVPQEGLKGLGTKLVE 121


>08_02_1181 - 24985963-24986242,24987109-24987197
          Length = 122

 Score = 99.5 bits (237), Expect = 1e-21
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +2

Query: 56  ERKGKSAINE-VVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRL 232
           E+KG +A  E VVTREYT+NLHKRLH   FKK+AP AIKEIRKFA+K MGT D+RVD +L
Sbjct: 3   EKKGGAARKEEVVTREYTINLHKRLHSCTFKKKAPNAIKEIRKFAQKAMGTTDVRVDVKL 62

Query: 233 NKFLWSKESEMFP 271
           NK +WS      P
Sbjct: 63  NKHIWSSGIRSVP 75



 Score = 37.1 bits (82), Expect = 0.006
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 396
           G+R+VP           ND+ED+  +L++LVT   VP   +KGL T+ VD
Sbjct: 70  GIRSVPRRVRVRIARKRNDEEDAKEELYSLVTVAEVPPEGLKGLGTKVVD 119


>02_05_0532 - 29814199-29814478,29814922-29814969,29815558-29815649
          Length = 139

 Score = 81.4 bits (192), Expect = 3e-16
 Identities = 43/80 (53%), Positives = 51/80 (63%), Gaps = 16/80 (20%)
 Frame = +2

Query: 80  NEVVTREYTVNLHKRLHGV----------------GFKKRAPRAIKEIRKFAEKQMGTPD 211
           +EVVTREYT+NLHKRLHG                  FKK+AP AIKEIRKFA+K MGT D
Sbjct: 13  DEVVTREYTINLHKRLHGCIVCSNDLIHYAPDIVSTFKKKAPNAIKEIRKFAQKAMGTTD 72

Query: 212 IRVDTRLNKFLWSKESEMFP 271
           IR+D +LNK +W+      P
Sbjct: 73  IRIDVKLNKAIWTNGIRSVP 92



 Score = 35.9 bits (79), Expect = 0.015
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 396
           G+R+VP           ND+ED+  +L++LVT   +P   +KGL T+ V+
Sbjct: 87  GIRSVPRRVRVRISRKRNDEEDAKEELYSLVTVAEIPAEGLKGLGTKVVE 136


>01_06_0668 +
           31058497-31059510,31059609-31059676,31060189-31060270,
           31060339-31060431,31060516-31060668,31060900-31060968,
           31061091-31061184,31061594-31061677,31062133-31062221,
           31062340-31062456,31062567-31062707,31062823-31063005
          Length = 728

 Score = 29.5 bits (63), Expect = 1.3
 Identities = 15/53 (28%), Positives = 26/53 (49%)
 Frame = +2

Query: 107 VNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSKESEM 265
           +N+   ++G GF   A   + E+ K A KQ+  PD    +  + ++ S  S M
Sbjct: 441 LNVDSAVYGAGFYASATPQLDELLKEASKQVQNPDNETQSLYDLWMASDSSSM 493


>03_02_0178 + 6195402-6199158,6199438-6200003
          Length = 1440

 Score = 26.6 bits (56), Expect = 9.0
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +2

Query: 20  TKLKITMAKPKGERKGKSAINEVVTREYTVNL 115
           T L + M KP  E KGK    +V+++E  + +
Sbjct: 704 TALNLIMGKPSAEDKGKGIAFDVLSKEEDIGV 735


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,658,395
Number of Sequences: 37544
Number of extensions: 188551
Number of successful extensions: 427
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 421
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 427
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 847740284
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -