SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30108.Seq
         (591 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1772 + 29411874-29413218,29413355-29413421,29413749-294138...    30   1.6  
01_06_1742 - 39585879-39585994,39586089-39586238,39586288-395863...    28   6.4  
06_01_0313 - 2250312-2250516,2250585-2250610,2250792-2251076,225...    27   8.5  
03_05_0769 - 27579251-27579934                                         27   8.5  

>07_03_1772 +
           29411874-29413218,29413355-29413421,29413749-29413896,
           29415293-29415416,29416340-29416590,29416923-29418449,
           29418786-29418896,29419576-29419734,29419827-29421734
          Length = 1879

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = +1

Query: 343 QKQVAICNYVCN*VVFLSIDNIGKHS*LHITQTIKTSSSSACISPLLDVNLSH 501
           +K V   N+    VV   +D + +H+ +  TQ  +  SSS+  SPLL + +++
Sbjct: 500 EKPVTTRNHAYAEVVVFVLDQMTRHTQVTSTQRKQARSSSSSASPLLSLRITY 552


>01_06_1742 -
           39585879-39585994,39586089-39586238,39586288-39586375,
           39586479-39586640,39586753-39586877,39586992-39587030,
           39587290-39587476,39587643-39587713,39589371-39589564,
           39589656-39589767,39589899-39590082,39590177-39590503,
           39590780-39591061,39591148-39591621,39591730-39591813,
           39591850-39591939,39592024-39592247,39592503-39592600,
           39592679-39593169,39593249-39593520,39594266-39594522,
           39594672-39594890,39595007-39595167,39595249-39595441,
           39595528-39595633,39595947-39596121,39596404-39596556,
           39596663-39596794,39597120-39597184,39597754-39597819,
           39598433-39598511,39598587-39598767,39598864-39598976
          Length = 1889

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 12/20 (60%), Positives = 14/20 (70%)
 Frame = +1

Query: 475 PLLDVNLSHSPHNARSSTFR 534
           PLL +  SH+PHN  SS FR
Sbjct: 899 PLLVLKPSHNPHNLLSSKFR 918


>06_01_0313 -
           2250312-2250516,2250585-2250610,2250792-2251076,
           2251289-2251567,2251817-2252121,2252581-2252860,
           2253209-2253475
          Length = 548

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 10/33 (30%), Positives = 20/33 (60%)
 Frame = +1

Query: 112 DEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALL 210
           DE+ PP S +D +  +E G +    +C++ +L+
Sbjct: 180 DEEGPPDSSQDILKFLENGLSRTYNDCFVESLI 212


>03_05_0769 - 27579251-27579934
          Length = 227

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = +1

Query: 52  TLMGVFYYIRAVALLEDLPFDEKNPPHSIEDF-VIEVEKGYTLNAQNC 192
           TL GV   +  V LL+  P    N P  ++DF V +++   TLN   C
Sbjct: 7   TLAGV---VLVVLLLQQAPVLRANDPDPLQDFCVADLDSEVTLNGYPC 51


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,767,527
Number of Sequences: 37544
Number of extensions: 305116
Number of successful extensions: 752
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 738
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 752
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1400060088
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -