SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30107.Seq
         (684 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_07_0278 - 42440405-42440515,42440765-42440830,42440995-424410...    31   1.1  
10_08_0154 + 15266430-15266953,15267748-15267820,15267893-152679...    30   2.0  
01_05_0540 + 23069954-23070103,23070170-23070251,23070298-230703...    29   2.6  
03_01_0151 + 1206555-1206998,1207112-1207543                           29   3.4  
10_08_0452 - 18038182-18038253,18038338-18038415,18038502-180385...    29   4.5  
10_01_0236 + 2486371-2486952                                           29   4.5  

>01_07_0278 -
           42440405-42440515,42440765-42440830,42440995-42441085,
           42441342-42441496,42441823-42442044,42442097-42442210,
           42442833-42442912,42443289-42443505
          Length = 351

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = -1

Query: 621 KKRGPRGPSRRLTRWSWWTANALHRP 544
           ++RG  GP RR   W  WT + +H P
Sbjct: 28  RQRGAPGPPRRCVDWFSWTESTVHGP 53


>10_08_0154 +
           15266430-15266953,15267748-15267820,15267893-15267949,
           15268248-15268303,15269584-15269797,15270497-15270538,
           15270661-15270735,15270820-15270903,15271880-15271944,
           15272436-15272655,15272820-15272908,15273326-15273440,
           15273519-15273554
          Length = 549

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 20/85 (23%), Positives = 37/85 (43%)
 Frame = +2

Query: 137 SEQIRSFLGR*DRSS*CVKSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKE 316
           +E+ R   G  DRS    K         ++ +R R+RE+     +  +  + P R+  +E
Sbjct: 92  AEKDRGKDGEKDRSKEAEKDRSRDRDRDRDSERDRRRERDSGRER--RSSSRPERRRTEE 149

Query: 317 TQNVKSXTSKVENNRRVRDLHARSI 391
            + V+    + E + R RD   R +
Sbjct: 150 EEMVRELQKERERSDRNRDYRDRDV 174


>01_05_0540 +
           23069954-23070103,23070170-23070251,23070298-23070355,
           23071276-23071318,23072262-23073341,23073448-23073509,
           23073759-23073855,23074703-23074984,23075073-23075147,
           23075223-23075276,23075373-23075515,23076567-23076858
          Length = 805

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +2

Query: 188 VKSARAGEGAQKEDQRSRKREQSKPEPKPAKGVT-VPTRKGIKETQNVKSXTSKVENNRR 364
           VKS   G+GAQ E     +R+    E    K VT    ++ ++E + +     K EN   
Sbjct: 321 VKSIFQGDGAQSEIAEKGRRDHDATEKSSKKDVTEAEAKEFLEEVRLIHRTFDKAENLFL 380

Query: 365 VRDL 376
           ++D+
Sbjct: 381 LKDM 384


>03_01_0151 + 1206555-1206998,1207112-1207543
          Length = 291

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 18/60 (30%), Positives = 26/60 (43%)
 Frame = +2

Query: 185 CVKSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRR 364
           CV  A A        +  R+R+  +P P+P        RK  +E +N +     VE NRR
Sbjct: 70  CVTQAAAPPVTAPATRAERRRK--RPRPRPRAAPPPEKRKKPEEAENQRMTHIAVERNRR 127


>10_08_0452 -
           18038182-18038253,18038338-18038415,18038502-18038579,
           18039112-18039168,18039276-18039349,18039424-18039495,
           18039609-18039670,18039861-18039962,18040378-18040490,
           18040809-18040940,18041156-18041243,18041617-18041711,
           18041793-18042023,18042567-18042680,18042765-18042866,
           18043091-18043207,18043301-18044146
          Length = 810

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +2

Query: 173 RSS*CVKSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKET 319
           RSS   KS   GEG + E   +  + ++K +P P K  T+  +   K +
Sbjct: 73  RSSSPTKSNSPGEGKRSESVAAGAKPEAKEKPSPKKPKTLGAKSDTKSS 121


>10_01_0236 + 2486371-2486952
          Length = 193

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRKREQSKPEPKPA 277
           ++ R+GEG  +  QR R  E++ P P PA
Sbjct: 112 RTPRSGEGQARAPQRRRPLERAAPLPPPA 140


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,233,957
Number of Sequences: 37544
Number of extensions: 260497
Number of successful extensions: 881
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 833
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 875
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1733104716
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -