SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30102.Seq
         (594 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_01_0762 - 5852168-5852266,5852409-5852569,5852691-5852823          116   2e-26
02_03_0219 + 16541350-16541482,16541605-16541765,16541863-165419...   115   3e-26
02_02_0303 - 8766264-8766362,8767112-8767272,8768160-8768289           77   1e-14
10_08_0314 + 16683473-16683564,16683945-16683945,16684057-166842...    29   2.8  
01_01_0365 - 2859617-2859722,2860047-2860489,2862232-2862391,286...    28   4.9  
01_07_0270 - 42417782-42417850,42418207-42418342,42418826-424191...    28   6.5  

>07_01_0762 - 5852168-5852266,5852409-5852569,5852691-5852823
          Length = 130

 Score =  116 bits (278), Expect = 2e-26
 Identities = 54/69 (78%), Positives = 62/69 (89%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR++VL+DALK+++NAEKRGKRQVLIRP SKVI+KFL VM  HGYIGEFE VDDHR+GK
Sbjct: 1   MVRVSVLNDALKTMYNAEKRGKRQVLIRPSSKVIIKFLIVMQKHGYIGEFEFVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVV L GRL
Sbjct: 61  IVVELNGRL 69



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWT-NLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDV + +IE WT  LLPSRQFGY+VL TS GIM HEEARR
Sbjct: 71  KCGVISPRFDVGVKEIESWTARLLPSRQFGYIVLTTSAGIMDHEEARR 118


>02_03_0219 +
           16541350-16541482,16541605-16541765,16541863-16541940,
           16543176-16543445
          Length = 213

 Score =  115 bits (276), Expect = 3e-26
 Identities = 53/69 (76%), Positives = 62/69 (89%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR++VL+DALK+++NAEKRGKRQV+IRP SKVI+KFL VM  HGYIGEFE VDDHR+GK
Sbjct: 1   MVRVSVLNDALKTMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEFVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVV L GRL
Sbjct: 61  IVVELNGRL 69



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWT-NLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDV + +IE WT  LLPSRQFGY+VL TS GIM HEEARR
Sbjct: 71  KCGVISPRFDVGVKEIESWTARLLPSRQFGYIVLTTSAGIMDHEEARR 118


>02_02_0303 - 8766264-8766362,8767112-8767272,8768160-8768289
          Length = 129

 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 34/65 (52%), Positives = 48/65 (73%)
 Frame = -3

Query: 448 VLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIVVNL 269
           +L+DAL+++ NAE+RGK   L++P S V+V FL +M   GYI +FE++D HR GKI V L
Sbjct: 5   ILNDALRTMVNAERRGKATALLQPISGVMVSFLNIMKHRGYIKKFEVIDPHRVGKINVEL 64

Query: 268 TGRLK 254
            GR+K
Sbjct: 65  HGRIK 69



 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 20/51 (39%), Positives = 34/51 (66%), Gaps = 1/51 (1%)
 Frame = -2

Query: 269 HRQTKKCGVISPRFDVPINDIERW-TNLLPSRQFGYLVLXTSGGIMXHEEA 120
           H + K C  ++ R D+   +IE++   +LP+RQ+GY+V+ T  G++ HEEA
Sbjct: 65  HGRIKDCKALTYRQDIRAKEIEQYRVRMLPTRQWGYVVITTPNGVLDHEEA 115


>10_08_0314 +
           16683473-16683564,16683945-16683945,16684057-16684268,
           16684655-16684747,16685106-16685160,16685480-16685566
          Length = 179

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/58 (25%), Positives = 32/58 (55%)
 Frame = -3

Query: 373 SKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIVVNLTGRLKSVVSFHLVLMFPSTILKD 200
           S +++K L V++    +G + ++   RA + + +  G  K   +FHL+  FP+ ++ D
Sbjct: 36  SVIVLKCLFVLLHDKKMGIYALIYVLRACRYIEDDEGIRKYFAAFHLLGSFPAAVIID 93


>01_01_0365 -
           2859617-2859722,2860047-2860489,2862232-2862391,
           2863431-2863516,2863648-2866272
          Length = 1139

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 2/25 (8%)
 Frame = -3

Query: 307 VDDHRAGKIVVNLTGRLK--SVVSF 239
           VDDH++G+I++   GRL    V+SF
Sbjct: 912 VDDHKSGEIILEFDGRLNKWGVISF 936


>01_07_0270 -
           42417782-42417850,42418207-42418342,42418826-42419108,
           42419459-42419507,42419614-42419616
          Length = 179

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 14/47 (29%), Positives = 21/47 (44%)
 Frame = +1

Query: 400 SLAFQHYV*ILRRHSIRSYAPWLRFSSRFVANRIXRGARYPIRPIVS 540
           + ++QHY   L    I     +L   S  V N + + A+ P RP  S
Sbjct: 58  TFSWQHYYWYLTNDGIEHLRSYLNLPSEVVPNTLKKSAKPPSRPFGS 104


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,813,778
Number of Sequences: 37544
Number of extensions: 229590
Number of successful extensions: 447
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 440
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 445
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1411925004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -