SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30101.Seq
         (454 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_0831 - 21810002-21810319,21810423-21810573,21810660-218108...    31   0.43 
04_03_0923 + 20843477-20845044,20846081-20846996                       31   0.57 
04_03_0772 - 19438910-19439209,19439692-19439828,19441334-194415...    28   3.1  
08_02_1389 - 26657739-26657890,26658097-26658171,26658372-266587...    28   4.0  
06_01_0244 - 1844161-1844241,1844356-1844394,1844510-1844617,184...    28   4.0  
02_02_0596 - 11976168-11976319,11976529-11976603,11976804-119771...    28   4.0  
04_03_0914 + 20788103-20789642,20790036-20790529                       27   5.3  
01_02_0099 + 11092529-11093140,11094153-11094424,11095378-110954...    27   7.1  
12_02_0417 - 18896949-18897269,18897340-18897424,18899561-188996...    27   9.3  
12_01_0329 + 2545511-2546683,2546983-2546993,2547377-2547438,254...    27   9.3  
11_06_0277 + 21843658-21845220,21846533-21846718,21847037-218471...    27   9.3  
04_04_0114 + 22861300-22861476,22864952-22864969,22865187-22867163     27   9.3  
03_02_0552 + 9416362-9417790,9417827-9417936,9418032-9418484           27   9.3  
02_02_0322 - 8938101-8938149,8938235-8938458,8938545-8938605,893...    27   9.3  

>07_03_0831 -
           21810002-21810319,21810423-21810573,21810660-21810897,
           21811011-21811221,21811336-21811559,21811696-21811806,
           21813265-21813636,21813810-21814782
          Length = 865

 Score = 31.1 bits (67), Expect = 0.43
 Identities = 13/43 (30%), Positives = 21/43 (48%)
 Frame = -3

Query: 236 HSVTAFDSVFLLLRTESSSGSDIRWTVLSHSTQTTFPAARILL 108
           H++T  D   L++    ++G+D+ W    H T T  P   I L
Sbjct: 129 HTLTIRDDGNLVISGSDAAGTDVEWESFHHPTDTFVPGMEIAL 171


>04_03_0923 + 20843477-20845044,20846081-20846996
          Length = 827

 Score = 30.7 bits (66), Expect = 0.57
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 7/61 (11%)
 Frame = -3

Query: 275 ILRRASDSGLFYGHS-VTAFDSVFLLLRT------ESSSGSDIRWTVLSHSTQTTFPAAR 117
           IL  A+ S ++  H+ +TA D++ +LL         SS+ S I W    + T T FP+A+
Sbjct: 108 ILDHATKSIIWSTHANITAKDTIAILLNNGNLVLRSSSNSSIIFWQSFDYPTDTLFPSAK 167

Query: 116 I 114
           I
Sbjct: 168 I 168


>04_03_0772 -
           19438910-19439209,19439692-19439828,19441334-19441570,
           19441948-19442149,19442761-19442858,19443082-19443665,
           19443725-19443882
          Length = 571

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +3

Query: 45  AMCILVYGNSEDDFCEIDSIEQEDPC 122
           A C+ V G S DD CE  ++  +D C
Sbjct: 83  AACLGVIGGSGDDLCEKAAVRYDDRC 108


>08_02_1389 -
           26657739-26657890,26658097-26658171,26658372-26658711,
           26659849-26659918,26660836-26660930
          Length = 243

 Score = 27.9 bits (59), Expect = 4.0
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%)
 Frame = +2

Query: 215 NRMLLRSVRKRDQSRKHGGECFSKGYCS-QSLIYEEASDCPEGXDCC 352
           +R+ L+S RK+    +HGGE     Y     LI    SD  +  + C
Sbjct: 174 HRVALKSGRKKGTGEQHGGEDLPPMYLDIDDLIITRTSDGEDSDELC 220


>06_01_0244 -
           1844161-1844241,1844356-1844394,1844510-1844617,
           1844638-1844685,1845058-1845111,1845214-1845268,
           1845442-1845522,1846238-1846615,1847196-1847401
          Length = 349

 Score = 27.9 bits (59), Expect = 4.0
 Identities = 16/36 (44%), Positives = 18/36 (50%)
 Frame = -1

Query: 220 SIPSFCCLGQSPVLALISDGQSSATVHKPPSLRHGS 113
           ++PS CCL  SP         S   VHKPP  R GS
Sbjct: 125 AVPSGCCLSSSP--------GSVIWVHKPPEGRRGS 152


>02_02_0596 -
           11976168-11976319,11976529-11976603,11976804-11977143,
           11978281-11978350,11979267-11979361
          Length = 243

 Score = 27.9 bits (59), Expect = 4.0
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%)
 Frame = +2

Query: 215 NRMLLRSVRKRDQSRKHGGECFSKGYCS-QSLIYEEASDCPEGXDCC 352
           +R+ L+S RK+    +HGGE     Y     LI    SD  +  + C
Sbjct: 174 HRVALKSGRKKGTGEQHGGEDLPPMYLDIDDLIITRTSDGEDSDELC 220


>04_03_0914 + 20788103-20789642,20790036-20790529
          Length = 677

 Score = 27.5 bits (58), Expect = 5.3
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = -3

Query: 203 LLRTESSSGSDIRWTVLSHSTQTTFPAARI 114
           L+ T  S+ S++ W    + T T FP A++
Sbjct: 136 LILTNPSNSSEVLWQSFDYPTDTLFPRAKL 165


>01_02_0099 +
           11092529-11093140,11094153-11094424,11095378-11095438,
           11095553-11095622,11095645-11095901,11096466-11096639
          Length = 481

 Score = 27.1 bits (57), Expect = 7.1
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +3

Query: 99  SIEQEDPCRREGGLCTVAEDCPSD 170
           S+E+ED C R GG   VA DC  D
Sbjct: 439 SMEKEDGCSRVGG--AVASDCVED 460


>12_02_0417 -
           18896949-18897269,18897340-18897424,18899561-18899656,
           18900418-18900476,18901285-18901359
          Length = 211

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 12/39 (30%), Positives = 19/39 (48%)
 Frame = -1

Query: 181 LALISDGQSSATVHKPPSLRHGSSCSMESISQKSSSLFP 65
           LA I+D Q   T+ +P  + HG+S  +         +FP
Sbjct: 89  LAAIADTQPQTTISRPQMVPHGASPGLGGQYMSQVPMFP 127


>12_01_0329 +
           2545511-2546683,2546983-2546993,2547377-2547438,
           2547882-2548225
          Length = 529

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 15/53 (28%), Positives = 22/53 (41%)
 Frame = +3

Query: 90  EIDSIEQEDPCRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCYGVSVKE 248
           EI   E   P      LC   + C +   AR         DG++CCY V++ +
Sbjct: 444 EISLYENATPDASFSWLCHDDDLCAAHCNARR-THTSSHTDGVQCCYKVNMSD 495


>11_06_0277 +
           21843658-21845220,21846533-21846718,21847037-21847165,
           21847256-21847415,21847846-21847955,21848038-21848247,
           21848473-21848730,21848810-21848885,21849217-21849350,
           21849928-21850007,21850265-21850316
          Length = 985

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
 Frame = +3

Query: 39  FCAMCILVYGN-SEDDFCEIDSIEQE 113
           FC + +L  G    DD CE++SI+ E
Sbjct: 565 FCCLKLLASGKLGNDDLCEVNSIDVE 590


>04_04_0114 + 22861300-22861476,22864952-22864969,22865187-22867163
          Length = 723

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 2/40 (5%)
 Frame = +3

Query: 81  DFCEIDSIEQEDPCRREGG--LCTVAEDCPSDIRARTGLC 194
           D C   +    D C+  GG   CT    C    R R+GLC
Sbjct: 562 DNCSKSAQGSTDFCKAHGGGKRCTWGTGCEKFARGRSGLC 601


>03_02_0552 + 9416362-9417790,9417827-9417936,9418032-9418484
          Length = 663

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 1/83 (1%)
 Frame = -3

Query: 323 KLLHISKID-CSSLSRNILRRASDSGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVLSH 147
           K++ + K+D CSSLS     R S +  F    + + D V  LL TES   + + +   +H
Sbjct: 34  KIVVLDKLDYCSSLSNLNPSRPSPNFKFVKGDIASADLVNYLLTTESID-TIMHFAAQTH 92

Query: 146 STQTTFPAARILLFNGIYFTEII 78
               +F  +     N IY T ++
Sbjct: 93  -VDNSFGNSFEFTKNNIYGTHVL 114


>02_02_0322 -
           8938101-8938149,8938235-8938458,8938545-8938605,
           8938724-8940761,8940797-8940908,8942037-8942047,
           8942293-8942443
          Length = 881

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 11/34 (32%), Positives = 22/34 (64%)
 Frame = +3

Query: 234 VSVKETRVGSTAENVSRKATAVNL*YMKKLQTVP 335
           V++ ET+  S +EN S K+   ++ Y++ L++ P
Sbjct: 87  VAISETKKNSASENSSEKSDGGHVKYLEVLESSP 120


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,374,652
Number of Sequences: 37544
Number of extensions: 215661
Number of successful extensions: 724
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 696
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 723
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 883560296
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -