SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30100.Seq
         (586 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_01_0618 - 4941906-4942118,4942231-4942343,4942534-4942651,494...    78   6e-15
02_01_0001 - 3864-4049,4861-4917,5514-5648,5710-5808,5884-5952,6...    77   8e-15
04_03_0988 - 21469811-21469831,21470823-21471047,21471327-214716...    70   1e-12
02_04_0214 - 20976977-20977171,20977499-20977611,20978041-209781...    70   2e-12
04_03_1011 - 21708503-21708544,21708689-21708898,21709000-217091...    68   6e-12
01_03_0161 + 13337265-13337297,13337880-13338017,13338211-133383...    64   8e-11
06_01_0452 + 3198475-3198962,3199062-3199191,3199332-3199497,319...    63   1e-10
05_01_0410 - 3234455-3234466,3234851-3234950,3235037-3235161,323...    63   1e-10
02_04_0182 + 20719782-20720033,20720502-20720605,20720693-207210...    63   1e-10
09_04_0345 + 16876489-16876614,16876718-16876876,16877989-168781...    58   5e-09
07_03_0651 + 20287661-20287701,20288034-20288124,20288737-202888...    42   4e-04
07_01_0621 - 4606739-4606894,4606976-4607098,4608199-4608288           40   0.002
02_05_0085 - 25697860-25698142,25698631-25698946,25700481-257005...    39   0.003
07_01_0656 - 4912985-4913143,4913700-4913822,4914081-4914215           38   0.008
10_08_0532 + 18580579-18580746,18581923-18581997,18582659-185838...    36   0.018
05_02_0053 - 6152204-6152329,6152817-6152981,6154698-6154883,615...    36   0.031
03_06_0089 - 31565454-31565517,31565594-31565618,31565743-315659...    35   0.041
07_03_0550 - 19356710-19357763,19358941-19359256,19359552-19359609     34   0.072
04_04_0598 - 26514226-26514545,26516080-26516302                       34   0.072
05_06_0017 + 24964168-24964275,24965384-24965506,24965617-24965751     34   0.096
04_04_1575 + 34548774-34549109,34549979-34550185                       33   0.13 
01_06_1771 + 39787895-39788223,39788419-39788518,39788640-39788774     33   0.13 
07_03_1717 - 28958309-28958581,28958678-28958842,28958944-289591...    33   0.17 
03_06_0376 + 33479776-33479958,33481055-33481236,33481345-334814...    32   0.39 
01_01_0474 - 3488739-3488876,3488996-3489118,3489878-3489991,349...    32   0.39 
03_06_0330 - 33178114-33178206,33178317-33178382,33179704-331798...    31   0.68 
06_01_0314 + 2255908-2255979,2256354-2256512,2257021-2257209,225...    31   0.89 
05_01_0489 - 4077365-4077502,4078105-4078227,4079019-4079135,407...    31   0.89 
08_02_0497 - 17811413-17811529,17811644-17811724,17812693-178128...    30   1.2  
10_08_0426 - 17817975-17818582,17819068-17819209,17819648-178197...    30   1.6  
03_04_0011 + 16398093-16398170,16401321-16401806,16401892-164023...    30   1.6  
03_02_0863 - 11889492-11889761,11890257-11890421,11890518-11890637     30   1.6  
01_06_1214 + 35470688-35471340,35471617-35471701,35471750-354719...    30   1.6  
07_03_1204 + 24855052-24855210,24855411-24855974,24856157-248562...    29   2.1  
03_01_0480 - 3676529-3676687,3676767-3676931,3677044-3677220,367...    29   2.1  
01_01_0829 + 6471032-6471870,6472490-6472685,6472772-6472956,647...    29   2.7  
04_03_0975 - 21370715-21370877,21371227-21371319,21371383-213714...    29   3.6  
03_02_0621 - 9923163-9923245,9924163-9924338,9924437-9924495,992...    29   3.6  
06_03_1238 - 28604921-28605385,28605810-28606055                       28   4.8  
02_05_0792 - 31777775-31778220,31778506-31778630,31778724-317789...    28   4.8  
02_04_0285 - 21585048-21585173,21585302-21585355,21585512-21585952     28   4.8  
12_01_1027 + 10529545-10529777,10530269-10530668                       28   6.3  
05_05_0229 - 23457438-23457629,23457706-23457828,23457913-234580...    28   6.3  
01_01_0255 + 2079112-2079196,2079334-2079514,2079712-2079853,207...    28   6.3  
06_03_1048 + 27146475-27146652,27146739-27146804,27146880-271469...    27   8.3  

>11_01_0618 -
           4941906-4942118,4942231-4942343,4942534-4942651,
           4942762-4942881,4942964-4943101,4943392-4943517,
           4943659-4943847,4943951-4944238,4944344-4944374,
           4945014-4945216
          Length = 512

 Score = 77.8 bits (183), Expect = 6e-15
 Identities = 41/88 (46%), Positives = 57/88 (64%), Gaps = 4/88 (4%)
 Frame = +1

Query: 256 LAKVDATQEQD--LAESYGVRGYPTLKFFRN-GSPI-DYSGGRQADDIISWLKKKTGPPA 423
           LAKVDA  E++  LA  Y ++G+PTLK FRN G  I +Y G R+A+ I+ +LKK+ GP +
Sbjct: 95  LAKVDANDEKNKPLATKYEIQGFPTLKIFRNQGKNIQEYKGPREAEGIVEYLKKQVGPAS 154

Query: 424 VEVTSAEQAKELIDANTVIVFGFFSDQS 507
            E+ S E A  LID   + + G FS+ S
Sbjct: 155 KEIKSPEDATNLIDDKKIYIVGIFSELS 182



 Score = 74.9 bits (176), Expect = 4e-14
 Identities = 34/74 (45%), Positives = 45/74 (60%)
 Frame = +2

Query: 92  ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKLT 271
           E VL L    F+  +    +++VEFYAPWCGHCK LAPEY KAA +L++ + PI   K+ 
Sbjct: 40  EAVLTLDADGFDEAVAKHPFMVVEFYAPWCGHCKKLAPEYEKAAQELSKHDPPIVLAKVD 99

Query: 272 QLKNRISPRATVYE 313
               +  P AT YE
Sbjct: 100 ANDEKNKPLATKYE 113



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 25/59 (42%), Positives = 36/59 (61%)
 Frame = +2

Query: 77  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           EV  E   +V++    + V  + + +LVEFYAPWCGHCK LAP   +AAT L  ++  +
Sbjct: 380 EVNDEPVKVVVADNVHDFVFKSGKNVLVEFYAPWCGHCKKLAPILDEAATTLKSDKDVV 438



 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 3/73 (4%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFR-NGSPIDYSGGRQADDIISWLK--KKTGPPAV 426
           +AK+DAT   D+   + V+GYPTL F   +G  + Y  GR AD+I+ ++K  K+T   A 
Sbjct: 439 IAKMDATAN-DVPSEFDVQGYPTLYFVTPSGKMVPYESGRTADEIVDFIKKNKETAGQAK 497

Query: 427 EVTSAEQAKELID 465
           E   +  A+ L D
Sbjct: 498 EKAESAPAEPLKD 510


>02_01_0001 -
           3864-4049,4861-4917,5514-5648,5710-5808,5884-5952,
           6419-6493,6619-6705,6873-6953,7021-7163,7262-7430,
           7538-7667,7753-8255
          Length = 577

 Score = 77.4 bits (182), Expect = 8e-15
 Identities = 31/69 (44%), Positives = 50/69 (72%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435
           LAKVDAT++ DLA+ Y V+G+PT+ FF +G P DY+G R  + I+SW+ KK  P    +T
Sbjct: 128 LAKVDATEDTDLAQKYDVQGFPTILFFIDGVPKDYNGARTKEAIVSWVNKKLAPGVQNIT 187

Query: 436 SAEQAKELI 462
           + ++A++++
Sbjct: 188 TVDEAEKIL 196



 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 25/49 (51%), Positives = 36/49 (73%)
 Frame = +2

Query: 89  EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           E +V +LS ANF   + +  +++VEFYAPWC HC++LAP+YA AA  L+
Sbjct: 72  ETHVFLLSAANFSDFLASHRHVMVEFYAPWCAHCQALAPDYAAAAADLS 120



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +2

Query: 161 EFYAPWCGHCKSLAPEYAKAATKL 232
           + YAPWCGHC+ L P Y K    L
Sbjct: 452 KIYAPWCGHCQELEPTYNKLGKHL 475


>04_03_0988 -
           21469811-21469831,21470823-21471047,21471327-21471634,
           21471864-21472234,21472327-21472430,21473086-21473325
          Length = 422

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 33/86 (38%), Positives = 48/86 (55%)
 Frame = +2

Query: 29  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 208
           +L+  +      A  +E P +  V+ L +++FE  +   +Y+ V+FYAPWCGHCK LAPE
Sbjct: 21  LLLLLSFHAAAAAAAEEFPRDGRVIELDESSFEAALGAIDYLFVDFYAPWCGHCKRLAPE 80

Query: 209 YAKAATKLAEEESPIN*RKLTQLKNR 286
             +AA  LA    PI   K+   K R
Sbjct: 81  LDEAAPVLAGLSEPIIVAKVNADKYR 106



 Score = 54.0 bits (124), Expect = 8e-08
 Identities = 26/70 (37%), Positives = 40/70 (57%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435
           +AKV+A + + L   YGV G+PTL  F +G PI+Y+G R+AD ++  L K   P    + 
Sbjct: 97  VAKVNADKYRKLGSKYGVDGFPTLMLFIHGVPIEYTGSRKADLLVRNLNKFVAPDVSILE 156

Query: 436 SAEQAKELID 465
           S    K  ++
Sbjct: 157 SDSAIKSFVE 166


>02_04_0214 -
           20976977-20977171,20977499-20977611,20978041-20978158,
           20978585-20978701,20978836-20978973,20979193-20979318,
           20979827-20980015,20980539-20980863,20980977-20981134
          Length = 492

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 34/70 (48%), Positives = 40/70 (57%)
 Frame = +2

Query: 44  AIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           A ALL LA        E VL L   NF  V+   ++I+VEFYAPWCGHC  LAPEY  AA
Sbjct: 10  AFALLLLA-SSAAAEGEAVLTLDAGNFTEVVGAHDFIVVEFYAPWCGHCNQLAPEYEAAA 68

Query: 224 TKLAEEESPI 253
             L   + P+
Sbjct: 69  AALRSHDPPV 78



 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 33/90 (36%), Positives = 57/90 (63%), Gaps = 6/90 (6%)
 Frame = +1

Query: 256 LAKVDATQE--QDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISWLKKKTGPPA 423
           LAKVDA+ +  + LA  +GV+GYPT++  R+      +Y+G R A  I+++LK++ GP +
Sbjct: 80  LAKVDASADLNRGLAGEHGVQGYPTIRILRDRGARSHNYAGPRDAAGIVAYLKRQAGPAS 139

Query: 424 VEV--TSAEQAKELIDANTVIVFGFFSDQS 507
           VE+  +++  A + I  + V+V G F + S
Sbjct: 140 VEIAASASPPAADSIANDGVVVVGVFPELS 169



 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           E V  + + +L+EFYAPWCGHC+ LAP   + A  L ++E  +
Sbjct: 382 EVVFNSGKNVLLEFYAPWCGHCQKLAPILEEVAVSLKDDEDVV 424


>04_03_1011 -
           21708503-21708544,21708689-21708898,21709000-21709112,
           21709232-21709349,21709386-21709412,21709671-21709808,
           21710069-21710194,21710279-21710467,21710598-21710885,
           21710937-21711024,21711120-21711298
          Length = 505

 Score = 67.7 bits (158), Expect = 6e-12
 Identities = 36/86 (41%), Positives = 55/86 (63%), Gaps = 4/86 (4%)
 Frame = +1

Query: 256 LAKVDATQEQ--DLAESYGVRGYPTLKFFRNG-SPI-DYSGGRQADDIISWLKKKTGPPA 423
           LAKVDA  E+  +L + YGV  YPT+K  +NG S +  Y G R+AD I+ +LK++ GP +
Sbjct: 106 LAKVDAYNERNKELKDKYGVYSYPTIKIMKNGGSDVRGYGGPREADGIVEYLKRQVGPAS 165

Query: 424 VEVTSAEQAKELIDANTVIVFGFFSD 501
           +++ SAE+A   +    VI+ G F +
Sbjct: 166 LKLESAEEAAHSVVDKGVILVGVFPE 191



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 27/62 (43%), Positives = 40/62 (64%)
 Frame = +2

Query: 23  MRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA 202
           + +LI ++   +G+   +E+  +E VL L   NF  V+    +I+V+FYAPWCGHCK LA
Sbjct: 11  LAILISSSPTAVGVDATEEL--KEAVLTLDAGNFSEVVAKHPFIVVKFYAPWCGHCKQLA 68

Query: 203 PE 208
           PE
Sbjct: 69  PE 70



 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRN-GSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +AK+D T   D+   + V GYPT+ F+ + G+ + Y G R A++IIS++ +  GP A   
Sbjct: 419 IAKMDGTVN-DIPTDFTVEGYPTIYFYSSSGNLLSYDGARTAEEIISFINENRGPKAGAA 477

Query: 433 TSAEQAKELIDA 468
            + ++ K  IDA
Sbjct: 478 AAVDE-KTQIDA 488



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +2

Query: 89  EENVLVLSKANFETVITTT-EYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244
           ++ V V+   N + ++  + + +L+EFYAPWCGHC+  A    + A  L +++
Sbjct: 363 DQPVKVVVADNIDDIVFNSGKNVLLEFYAPWCGHCRKFALILEEIAVSLQDDQ 415


>01_03_0161 +
           13337265-13337297,13337880-13338017,13338211-13338308,
           13338395-13338450,13338664-13338781,13338889-13338916,
           13339021-13339112,13339321-13339477,13339569-13339693,
           13339785-13339884,13339991-13340059
          Length = 337

 Score = 64.1 bits (149), Expect = 8e-11
 Identities = 28/55 (50%), Positives = 38/55 (69%), Gaps = 2/55 (3%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 414
           +A +DA + +DLAE YGV GYPTLKFF  G+    DY GGR+ DD + ++ +K G
Sbjct: 174 IANLDADKHKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRELDDFVKFINEKCG 228



 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 25/45 (55%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = +2

Query: 95  NVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           +V+VL   NF++++    + ILVEFYAPWCGHCK LAP Y K A+
Sbjct: 120 SVVVLGPDNFDSIVLDENKDILVEFYAPWCGHCKHLAPIYEKLAS 164



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 414
           +AKVD  + + +   YGV GYPT+++F  GS  P  Y G R A+ +  ++  + G
Sbjct: 55  IAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRSAEALAEFVNTEGG 109



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = +2

Query: 167 YAPWCGHCKSLAPEYAKAATKLAEEES 247
           Y   CGHCK LAPEY K      + +S
Sbjct: 26  YLVRCGHCKKLAPEYEKLGASFKKAKS 52


>06_01_0452 +
           3198475-3198962,3199062-3199191,3199332-3199497,
           3199765-3199883,3200056-3200136,3200236-3200322,
           3200644-3200715,3200791-3200859,3201349-3201426,
           3201540-3201680,3202333-3202386,3202465-3202581
          Length = 533

 Score = 63.3 bits (147), Expect = 1e-10
 Identities = 27/81 (33%), Positives = 46/81 (56%)
 Frame = +1

Query: 259 AKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTS 438
           AK+D  +    A + GV+G+PT+  F NG+   ++G    D I++W++KKTG PA  + S
Sbjct: 124 AKLDGERYPKAASAVGVKGFPTVLLFVNGTEHQFTGLHTKDAIVTWVRKKTGAPASRIQS 183

Query: 439 AEQAKELIDANTVIVFGFFSD 501
            + A+E +  +     G F +
Sbjct: 184 KDSAEEFLKKDQTFAVGLFKN 204



 Score = 37.1 bits (82), Expect = 0.010
 Identities = 20/57 (35%), Positives = 26/57 (45%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKL 268
           VLVL   N    +     +L+  YAPWC     L P +A+AA  L    S +   KL
Sbjct: 70  VLVLDNDNARRAVEENAEVLLLGYAPWCERSAQLMPRFAEAAAALRAMGSAVAFAKL 126



 Score = 31.1 bits (67), Expect = 0.68
 Identities = 13/52 (25%), Positives = 29/52 (55%), Gaps = 2/52 (3%)
 Frame = +2

Query: 74  DEVPTEENVL--VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           + VP E+  +  V+ +    +V+ + + + +E +APWC  C++++    K A
Sbjct: 399 EPVPEEKGPIEKVVGRTFDSSVLESPQNVFLEVHAPWCVDCEAISKNVEKLA 450


>05_01_0410 -
           3234455-3234466,3234851-3234950,3235037-3235161,
           3235244-3235400,3235644-3235735,3235828-3235855,
           3235949-3236066,3236411-3236466,3236556-3236653,
           3236864-3236948,3237428-3237600
          Length = 347

 Score = 63.3 bits (147), Expect = 1e-10
 Identities = 28/74 (37%), Positives = 41/74 (55%)
 Frame = +2

Query: 26  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 205
           R  + + + L+  A      + ++VL L+++ FE  +      LVEFYAPWCGHCK LAP
Sbjct: 8   RKALASLLLLVAAAAAVSTASADDVLALTESTFEKEVGQDRAALVEFYAPWCGHCKKLAP 67

Query: 206 EYAKAATKLAEEES 247
           EY K      + +S
Sbjct: 68  EYEKLGASFKKAKS 81



 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 1/54 (1%)
 Frame = +2

Query: 95  NVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           +V+VL+   F++V+   T+ +LVEFYAPWCGHCK LAP Y K A+   ++E  +
Sbjct: 149 SVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCKHLAPIYEKLASVYKQDEGVV 202



 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 414
           +A +DA +   LAE YGV G+PTLKFF  G+    DY GGR+ DD + ++ +K G
Sbjct: 203 IANLDADKHTALAEKYGVSGFPTLKFFPKGNKAGEDYDGGRELDDFVKFINEKCG 257



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKK 408
           S  +AKVD  + + +   YGV GYPT+++F  GS  P  Y G R A+ +  ++  +
Sbjct: 81  SVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEYVNSE 136


>02_04_0182 +
           20719782-20720033,20720502-20720605,20720693-20721066,
           20721302-20721609,20721853-20722092
          Length = 425

 Score = 63.3 bits (147), Expect = 1e-10
 Identities = 26/59 (44%), Positives = 36/59 (61%)
 Frame = +2

Query: 77  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           ++P +  VL L   NF+  +     + V+FYAPWCGHCK LAP+  +AA  LA   +PI
Sbjct: 41  QIPRDGRVLELDDGNFDAAVRAAGLLFVDFYAPWCGHCKRLAPQLDEAAPVLAGLSTPI 99



 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 32/87 (36%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435
           +AKV+A + + L   YGV G+PTL  F +G+P +Y+G R+AD ++  LKK   P    + 
Sbjct: 101 VAKVNADKYKKLGSKYGVDGFPTLMLFDHGTPTEYTGSRKADLLVENLKKLVAPDVSVLE 160

Query: 436 SAEQAKELI-DANT--VIVFGFFSDQS 507
           S    K  + DA     +  GF  D+S
Sbjct: 161 SDSAIKSFVEDAGMGFPLFLGFGVDES 187


>09_04_0345 +
           16876489-16876614,16876718-16876876,16877989-16878102,
           16878701-16878882,16879142-16879241,16879597-16879638,
           16879818-16879994,16880084-16880175,16880633-16880779,
           16880832-16881036
          Length = 447

 Score = 58.0 bits (134), Expect = 5e-09
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 2/56 (3%)
 Frame = +2

Query: 71  GDEVPTEENVLV-LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 232
           G    TE +  + L+  NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KAA  L
Sbjct: 157 GSSEKTEPSASIELNSQNFDKLVTKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNL 212



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 21/43 (48%), Positives = 30/43 (69%), Gaps = 1/43 (2%)
 Frame = +2

Query: 98  VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           VL  +  NF++ V+ +   +LVEF+APWCGHC+ L P + KAA
Sbjct: 31  VLQFNPNNFKSKVLNSNGVVLVEFFAPWCGHCQQLTPIWEKAA 73



 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISW 396
           +A +DA   ++LA+ YG+RG+PT+K F  G  P+DY G R    I+ +
Sbjct: 82  VAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIVEF 129


>07_03_0651 +
           20287661-20287701,20288034-20288124,20288737-20288831,
           20289433-20289523,20290066-20290250,20290590-20290647,
           20290812-20290852,20290935-20291009,20292298-20292354,
           20292480-20292546,20292754-20292900,20292986-20293210,
           20293332-20293493,20293570-20293647,20293735-20293812
          Length = 496

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG 369
           LAKVD T+E DL   + ++GYP+++ FR GS +  + G
Sbjct: 212 LAKVDCTEEIDLCRRHHIQGYPSIRIFRKGSDLKENQG 249



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = +2

Query: 71  GDEVPT--EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244
           GD+V    ++  + LS  NF++       ++V FYAPWC     L P + K A  + E  
Sbjct: 143 GDDVEENHDDGSVPLSSRNFDSYSHQYPVLVVNFYAPWCYWSNRLKPSWEKTAKIMRERY 202

Query: 245 SP 250
            P
Sbjct: 203 DP 204


>07_01_0621 - 4606739-4606894,4606976-4607098,4608199-4608288
          Length = 122

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/59 (30%), Positives = 31/59 (52%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTS 438
           KVD  + +++AE Y V   PT  F ++G+  D   G + DD+ + + K  G  A   ++
Sbjct: 64  KVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASASA 122



 Score = 35.1 bits (77), Expect = 0.041
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 6/53 (11%)
 Frame = +2

Query: 89  EENVLVL--SKANFETVITTTE----YILVEFYAPWCGHCKSLAPEYAKAATK 229
           EE V++   +K  F+  +T  +     ++++F A WCG C+ +AP +A+ A K
Sbjct: 4   EEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKK 56


>02_05_0085 -
           25697860-25698142,25698631-25698946,25700481-25700518,
           25700955-25701036,25701815-25702016
          Length = 306

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = +2

Query: 107 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKLTQLKN 283
           ++K+ +++++  +E  +LVEF+A WCG CK + P   K +    E E  +N  KL   +N
Sbjct: 111 VTKSTWQSLVVESELPVLVEFWASWCGPCKMIDPVIGKLS---KEYEGKLNCYKLNTDEN 167



 Score = 34.7 bits (76), Expect = 0.055
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEVTS 438
           K++  +  D+A  +G+R  PT+  F+NG   D   G      ++S + K  G    E ++
Sbjct: 161 KLNTDENPDIATQFGIRSIPTMMIFKNGEKKDAVIGAVPESTLVSSIDKYIGR---ETST 217

Query: 439 AEQAKELID 465
            + A++++D
Sbjct: 218 QDLAEQVVD 226


>07_01_0656 - 4912985-4913143,4913700-4913822,4914081-4914215
          Length = 138

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +2

Query: 65  ALGDEVPTEENVLVLSKANFETVI----TTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           A G+E      V V SKA ++ +      TT+ ++++F A WCG CK + P + + A + 
Sbjct: 13  AAGEEGGESAVVAVHSKAKWDELWDAHKNTTKLVVIDFSASWCGPCKMMEPVFKEMAGRF 72

Query: 233 AE 238
            +
Sbjct: 73  TD 74


>10_08_0532 +
           18580579-18580746,18581923-18581997,18582659-18583887,
           18584853-18585013,18585272-18585279,18587737-18588768
          Length = 890

 Score = 36.3 bits (80), Expect = 0.018
 Identities = 15/55 (27%), Positives = 29/55 (52%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 426
           +V+A ++ +++E+YGV   P   F + G  +D   G     + + + K  GP +V
Sbjct: 56  RVEAEEQPEISEAYGVTAVPYFVFLKEGKTVDTLEGANPASLANKVAKLAGPASV 110


>05_02_0053 -
           6152204-6152329,6152817-6152981,6154698-6154883,
           6155055-6155078,6155649-6155822
          Length = 224

 Score = 35.5 bits (78), Expect = 0.031
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++VEFY  WCG C++L P   + A +
Sbjct: 110 VIVEFYGTWCGSCRALFPRLCRTAVE 135


>03_06_0089 -
           31565454-31565517,31565594-31565618,31565743-31565927,
           31566302-31566405,31567148-31567366,31567721-31567903
          Length = 259

 Score = 35.1 bits (77), Expect = 0.041
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = +2

Query: 101 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAK 217
           L  +   +E  ++  +  +VEFYA WC  C+ LAP+  K
Sbjct: 125 LAANATPYEEALSNGKPTVVEFYADWCEVCRELAPDVYK 163


>07_03_0550 - 19356710-19357763,19358941-19359256,19359552-19359609
          Length = 475

 Score = 34.3 bits (75), Expect = 0.072
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +2

Query: 59  GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATK 229
           G A   ++     V+ L++A  E ++   +  E  LV  YAPWC  C+++   Y + A +
Sbjct: 350 GSAGAPDIFESSGVVSLTRAGVENLLRLESRAEPWLVVLYAPWCPFCQAMEASYLELAER 409

Query: 230 L 232
           L
Sbjct: 410 L 410


>04_04_0598 - 26514226-26514545,26516080-26516302
          Length = 180

 Score = 34.3 bits (75), Expect = 0.072
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID 357
           K++  +  D+A  YGVR  PT+  F+NG   D
Sbjct: 128 KLNTDENPDIASQYGVRSIPTMMIFKNGEKKD 159



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +2

Query: 86  TEENVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAK 217
           T   V  ++K+ +++++  +E  +LV ++A WCG CK + P   K
Sbjct: 71  TSIQVPEVTKSTWQSLVMESELPVLVGYWATWCGPCKMIDPVVGK 115


>05_06_0017 + 24964168-24964275,24965384-24965506,24965617-24965751
          Length = 121

 Score = 33.9 bits (74), Expect = 0.096
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 229
           E   +  + ++++F A WCG C+ +AP +A  A K
Sbjct: 28  EEANSAKKLVVIDFTASWCGPCRIIAPVFADLAKK 62



 Score = 31.1 bits (67), Expect = 0.68
 Identities = 15/47 (31%), Positives = 23/47 (48%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLK 402
           KVD  + + +AE + V   PT  F + G   D   G   D++ S L+
Sbjct: 70  KVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAMKDELASKLE 116


>04_04_1575 + 34548774-34549109,34549979-34550185
          Length = 180

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 205
           V  + ++ FE  +  ++  +LV+F A WCG C+ +AP
Sbjct: 69  VRFIGQSEFEAEVLQSDLPVLVDFVADWCGPCRLIAP 105



 Score = 27.5 bits (58), Expect = 8.3
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 354
           ++ K+D      L E Y V G P+L  F++G  +
Sbjct: 119 KIVKIDHDANPQLIEEYKVYGLPSLILFKDGKEV 152


>01_06_1771 + 39787895-39788223,39788419-39788518,39788640-39788774
          Length = 187

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
 Frame = +2

Query: 65  ALGDEVPTEENVLVLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 229
           A  + V     V  ++K  F  ++ +   + ++++ Y  WCG CK +AP++ + + K
Sbjct: 71  AEAEAVAVTGQVTEVNKDTFWPIVKSAGPKVVVLDMYTQWCGPCKVMAPKFQEMSEK 127


>07_03_1717 -
           28958309-28958581,28958678-28958842,28958944-28959120,
           28959315-28959539
          Length = 279

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 12/29 (41%), Positives = 21/29 (72%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           ++V+F++P CG C++L P+ A+ A K  E
Sbjct: 116 VVVDFFSPGCGGCRALHPKIAQLAEKNPE 144


>03_06_0376 +
           33479776-33479958,33481055-33481236,33481345-33481469,
           33481858-33482057,33482629-33482762,33483095-33483158,
           33483764-33484441,33484723-33484839
          Length = 560

 Score = 31.9 bits (69), Expect = 0.39
 Identities = 13/55 (23%), Positives = 25/55 (45%)
 Frame = +1

Query: 250 YQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 414
           Y     +++    L   YGVRG+P +      + + Y G +    ++ + K+ TG
Sbjct: 110 YHFTVEESSAMPSLFSRYGVRGFPAILLVNETTMVRYWGPKDLSSLVDFYKETTG 164


>01_01_0474 -
           3488739-3488876,3488996-3489118,3489878-3489991,
           3490416-3490452,3490584-3490675,3490878-3490956,
           3491640-3491734,3491858-3491991,3492560-3492833,
           3493743-3494015,3494976-3495512
          Length = 631

 Score = 31.9 bits (69), Expect = 0.39
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 5/46 (10%)
 Frame = +2

Query: 95  NVLVLS-KANFETVITTT----EYILVEFYAPWCGHCKSLAPEYAK 217
           NV V+S K N++  I       + ++  F A WCG C+ +AP YA+
Sbjct: 522 NVHVISNKENWDHKIAEANKDGKIVIANFSAAWCGPCRVIAPVYAE 567



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 10/36 (27%), Positives = 18/36 (50%)
 Frame = +1

Query: 250 YQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 357
           +    +D  +  D + S+ +R  PT  F +NG  +D
Sbjct: 575 FMFLTIDVDELMDFSSSWDIRATPTFFFLKNGEQVD 610


>03_06_0330 -
           33178114-33178206,33178317-33178382,33179704-33179826,
           33179930-33180067
          Length = 139

 Score = 31.1 bits (67), Expect = 0.68
 Identities = 10/29 (34%), Positives = 18/29 (62%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           I+++F A WCG C+ + P +   A + A+
Sbjct: 47  IVIDFSATWCGPCRFIEPAFKDMAGRFAD 75


>06_01_0314 +
           2255908-2255979,2256354-2256512,2257021-2257209,
           2257390-2257561,2257711-2257784,2257818-2257904,
           2257975-2257998,2258100-2258225
          Length = 300

 Score = 30.7 bits (66), Expect = 0.89
 Identities = 19/56 (33%), Positives = 28/56 (50%)
 Frame = -2

Query: 549 RQLEQLKGKFWLWLALVRKETKYNNSIGIDKFFSLFSRGDLNSRGASLLLQPTDDV 382
           R    L G  W+WL L RKE K+ + +      S  + GD+N+   S+ L   DD+
Sbjct: 183 RSALSLLGSGWVWLVLKRKERKF-SVVHTQNAISPLALGDINNSIPSINL--CDDI 235


>05_01_0489 -
           4077365-4077502,4078105-4078227,4079019-4079135,
           4079243-4079263
          Length = 132

 Score = 30.7 bits (66), Expect = 0.89
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAK 217
           ++  F A WCG C+ +AP YA+
Sbjct: 47  VVANFSASWCGPCRVIAPIYAE 68


>08_02_0497 -
           17811413-17811529,17811644-17811724,17812693-17812815,
           17812945-17813193
          Length = 189

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 14/25 (56%), Positives = 15/25 (60%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFF 336
           KVD   E +LA    VRG PTL FF
Sbjct: 137 KVDTDDEYELARDMQVRGLPTLYFF 161



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++V+FYA WCG C  +A +    A +
Sbjct: 103 LIVDFYATWCGPCVLMAQDIEMLAVE 128


>10_08_0426 -
           17817975-17818582,17819068-17819209,17819648-17819745,
           17820070-17821897,17822331-17822738,17822891-17822943,
           17823461-17823877,17824401-17824605
          Length = 1252

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 104 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 208
           VL++ANF + I    +IL+    PW G  +SL  E
Sbjct: 45  VLTRANFSSQIRLHPHILLVVTMPWYGESRSLMAE 79


>03_04_0011 +
           16398093-16398170,16401321-16401806,16401892-16402380,
           16402810-16403466
          Length = 569

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEES 247
           +L+ F A WCG C++  P+      K+ E+ +
Sbjct: 362 VLLYFSAKWCGPCRAFLPKLVDEYNKIKEKHN 393


>03_02_0863 - 11889492-11889761,11890257-11890421,11890518-11890637
          Length = 184

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 9/24 (37%), Positives = 18/24 (75%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAA 223
           ++V+F++P CG C++L P+  + A
Sbjct: 22  VIVDFFSPGCGGCRALHPKICQIA 45


>01_06_1214 +
           35470688-35471340,35471617-35471701,35471750-35471906,
           35472086-35472189
          Length = 332

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = +1

Query: 244 ISYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG--RQADDIISWL 399
           I +Q  KVD   E+DLA +  V+  P L F R G+ I Y     R AD+++  +
Sbjct: 258 IEFQTVKVDMNIERDLAFALQVKECPQLLFLR-GNKILYREKELRTADELVQMI 310


>07_03_1204 +
           24855052-24855210,24855411-24855974,24856157-24856225,
           24856304-24856426,24856733-24856864,24857143-24857266,
           24857547-24857614,24857849-24857991,24858615-24858722,
           24858826-24858901,24859442-24859578,24859660-24859819,
           24859901-24860080,24860159-24860275,24860540-24860695,
           24861209-24861379,24861479-24861591,24861669-24861792,
           24861961-24862056,24862139-24862201,24862299-24862364
          Length = 982

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 11/36 (30%), Positives = 21/36 (58%)
 Frame = +3

Query: 138 QPRSTF*LNSMLHGAATANLWHRNTPRQQQSWLKKN 245
           Q RS   + + LH     N++  +TPR+ ++W++ N
Sbjct: 311 QLRSLLEMKNALHTDIDVNIYDGDTPREDRTWIRDN 346


>03_01_0480 -
           3676529-3676687,3676767-3676931,3677044-3677220,
           3678170-3678273,3678700-3678843,3679831-3679898,
           3680059-3680162,3680759-3680767,3681572-3681657,
           3681918-3683373
          Length = 823

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 10/33 (30%), Positives = 21/33 (63%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           + ++ + +  +V F++P CG CK+L P+  + A
Sbjct: 689 QLLLASDKLTVVHFFSPSCGACKALHPKVCQLA 721


>01_01_0829 +
           6471032-6471870,6472490-6472685,6472772-6472956,
           6473206-6473539,6473629-6473833,6474927-6475033,
           6475117-6475269
          Length = 672

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 354
           S    KVD ++   +A +  VR  PT K ++NG+ +
Sbjct: 617 SISFLKVDISESPAVARAENVRTVPTFKIYKNGTRV 652


>04_03_0975 -
           21370715-21370877,21371227-21371319,21371383-21371466,
           21371745-21371869,21372360-21372600,21373640-21373734
          Length = 266

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCK 193
           +L+EF+A WCG C+
Sbjct: 36  VLIEFWASWCGPCR 49


>03_02_0621 -
           9923163-9923245,9924163-9924338,9924437-9924495,
           9924952-9924984,9925060-9925185
          Length = 158

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +2

Query: 158 VEFYAPWCGHCKSL 199
           V+F  PWC HCK+L
Sbjct: 63  VKFCVPWCKHCKNL 76


>06_03_1238 - 28604921-28605385,28605810-28606055
          Length = 236

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 13/36 (36%), Positives = 23/36 (63%)
 Frame = +3

Query: 240 KNLLSTSES*RNSRTGSRRELRCTRIPDSQILQEWQ 347
           KN  STSE+ +++  GS +     ++P+  ILQE++
Sbjct: 126 KNSPSTSETTQSAHLGSTQHCAPEQVPEHSILQEYK 161


>02_05_0792 -
           31777775-31778220,31778506-31778630,31778724-31778911,
           31779716-31779892
          Length = 311

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = +2

Query: 71  GDEVPT-EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 211
           GD V   E + + L+KA     +   +YI V FYA WC   +   P +
Sbjct: 52  GDPVGVIEGDEVTLAKAITLLHMNKDDYIAVLFYASWCPFSQECKPNF 99


>02_04_0285 - 21585048-21585173,21585302-21585355,21585512-21585952
          Length = 206

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +1

Query: 265 VDATQEQ-DLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 417
           +D   EQ ++A+   ++  P   F++NG  ++    R  + II+ ++K T P
Sbjct: 149 IDEYDEQSEVADRLRIKVVPLFHFYKNGVLLEAFATRDKERIIAAIQKYTAP 200


>12_01_1027 + 10529545-10529777,10530269-10530668
          Length = 210

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 10/28 (35%), Positives = 18/28 (64%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           +++EF A WC   + +AP +A+ A + A
Sbjct: 7   VVIEFGASWCEPSRRIAPVFAEYAKEFA 34


>05_05_0229 -
           23457438-23457629,23457706-23457828,23457913-23458026,
           23462062-23462597,23463258-23464545
          Length = 750

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 11/35 (31%), Positives = 21/35 (60%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 229
           E V    + ++++F A WC  C++ AP +A+ + K
Sbjct: 638 EEVAEHGKTVVLKFSAIWCTPCRNAAPLFAELSLK 672


>01_01_0255 +
           2079112-2079196,2079334-2079514,2079712-2079853,
           2079934-2080003,2080140-2080303
          Length = 213

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +1

Query: 307 VRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAV 426
           VR + T K F    P+ D  GG +A DII W +++     V
Sbjct: 5   VRTHRTTKLFGRERPLHDALGGHKAADIILWRERRVSASIV 45


>06_03_1048 +
           27146475-27146652,27146739-27146804,27146880-27146975,
           27147073-27147152,27148165-27148209,27148326-27148420,
           27148623-27148632
          Length = 189

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 8/22 (36%), Positives = 16/22 (72%)
 Frame = +2

Query: 164 FYAPWCGHCKSLAPEYAKAATK 229
           + A WCG C+++AP  +K +++
Sbjct: 106 YTAVWCGPCRAMAPVISKLSSR 127


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,068,606
Number of Sequences: 37544
Number of extensions: 299900
Number of successful extensions: 870
Number of sequences better than 10.0: 45
Number of HSP's better than 10.0 without gapping: 806
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 863
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1376330256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -