SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30099.Seq
         (730 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0548 + 4099386-4099847,4100435-4101316                          181   6e-46
03_01_0547 + 4093196-4093657,4094267-4095148                          181   6e-46
03_01_0544 + 4082528-4082989,4083585-4084466                          181   6e-46
03_01_0543 + 4076981-4077442,4078145-4079026                          181   6e-46
02_03_0105 - 15254959-15255216,15256235-15256299,15257080-152572...   113   1e-25
04_04_1593 - 34661670-34661798,34661882-34661989,34662129-346623...   111   7e-25
04_03_0107 + 11328267-11328276,11329059-11329170,11329862-113299...   107   7e-24
04_04_1015 - 30115377-30115477,30115570-30115615,30116491-301165...   100   1e-21
04_04_1008 - 30054674-30054774,30054867-30054912,30055788-300558...   100   1e-21
03_06_0699 - 35612919-35612989,35613079-35613319,35613506-356135...    71   9e-13
02_04_0462 + 23131433-23132836                                         67   2e-11
12_01_0491 - 3884764-3885114,3885143-3885403,3885493-3885711,388...    36   0.033
06_01_0325 - 2366193-2366367,2367063-2367122,2367323-2367463,236...    33   0.23 
09_04_0730 + 19783346-19783372,19783548-19783638,19783973-197840...    33   0.31 
06_03_0715 - 23823427-23823525,23823616-23823822,23823907-238240...    32   0.41 
03_05_0044 + 20203644-20204054,20204695-20204916,20205092-202051...    32   0.41 
03_05_0511 + 25056018-25059107                                         32   0.54 
02_04_0148 - 20198407-20201424                                         31   0.71 
01_06_0734 + 31569017-31569358,31569832-31569906,31570009-315701...    31   0.71 
04_04_0640 - 26891552-26891725,26891814-26892326,26892698-268936...    31   1.2  
04_01_0103 + 1082077-1082167,1083037-1085477                           31   1.2  
02_04_0017 + 18937774-18937864,18938505-18940945                       31   1.2  
02_01_0432 - 3144560-3144655,3144792-3144832,3145019-3145094,314...    31   1.2  
01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912     30   1.6  
01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430...    30   1.6  
12_02_0457 + 19239816-19241319,19241337-19241632,19241729-192418...    30   2.2  
01_06_0662 + 30987187-30987277,30987825-30990214                       30   2.2  
05_07_0329 - 29308867-29308932,29309040-29309159,29309245-293093...    29   2.9  
03_04_0151 - 17729023-17729372,17729441-17730623,17730723-177309...    29   2.9  
12_02_1094 + 26032135-26032164,26032975-26033152,26033234-260340...    29   3.8  
04_03_0961 + 21263735-21263773,21264157-21264279,21266774-212668...    29   3.8  
01_01_1168 - 9305084-9307172,9307751-9308460,9308624-9308821           29   3.8  
01_01_0016 - 88825-90411                                               29   3.8  
05_04_0116 + 18131510-18133192                                         29   5.0  
04_03_0320 - 14316934-14318550                                         29   5.0  
04_03_1034 - 21865633-21865811,21865838-21865860,21866345-218664...    28   6.6  
04_04_1357 + 32860677-32860781,32861484-32861588,32861678-328617...    28   8.7  
04_04_0214 - 23674270-23676858,23677574-23680843,23680941-236811...    28   8.7  
04_03_0106 + 11325172-11325379,11326590-11326640,11326987-113270...    28   8.7  
03_05_0339 + 23287620-23287676,23287784-23287849,23287937-232880...    28   8.7  
03_02_0712 - 10600147-10600196,10600257-10600378,10600993-106014...    28   8.7  

>03_01_0548 + 4099386-4099847,4100435-4101316
          Length = 447

 Score =  181 bits (440), Expect = 6e-46
 Identities = 85/125 (68%), Positives = 99/125 (79%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHAL
Sbjct: 79  KFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQ+I   NKMD+T P Y      +  ++     KK+GYNP  + FVPISG+ G
Sbjct: 139 LAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEG 198

Query: 617 DNMLE 631
           DNM+E
Sbjct: 199 DNMIE 203



 Score =  132 bits (320), Expect = 2e-31
 Identities = 62/68 (91%), Positives = 63/68 (92%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>03_01_0547 + 4093196-4093657,4094267-4095148
          Length = 447

 Score =  181 bits (440), Expect = 6e-46
 Identities = 85/125 (68%), Positives = 99/125 (79%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHAL
Sbjct: 79  KFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQ+I   NKMD+T P Y      +  ++     KK+GYNP  + FVPISG+ G
Sbjct: 139 LAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEG 198

Query: 617 DNMLE 631
           DNM+E
Sbjct: 199 DNMIE 203



 Score =  132 bits (320), Expect = 2e-31
 Identities = 62/68 (91%), Positives = 63/68 (92%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>03_01_0544 + 4082528-4082989,4083585-4084466
          Length = 447

 Score =  181 bits (440), Expect = 6e-46
 Identities = 85/125 (68%), Positives = 99/125 (79%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHAL
Sbjct: 79  KFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQ+I   NKMD+T P Y      +  ++     KK+GYNP  + FVPISG+ G
Sbjct: 139 LAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEG 198

Query: 617 DNMLE 631
           DNM+E
Sbjct: 199 DNMIE 203



 Score =  132 bits (320), Expect = 2e-31
 Identities = 62/68 (91%), Positives = 63/68 (92%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>03_01_0543 + 4076981-4077442,4078145-4079026
          Length = 447

 Score =  181 bits (440), Expect = 6e-46
 Identities = 85/125 (68%), Positives = 99/125 (79%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHAL
Sbjct: 79  KFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQ+I   NKMD+T P Y      +  ++     KK+GYNP  + FVPISG+ G
Sbjct: 139 LAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEG 198

Query: 617 DNMLE 631
           DNM+E
Sbjct: 199 DNMIE 203



 Score =  132 bits (320), Expect = 2e-31
 Identities = 62/68 (91%), Positives = 63/68 (92%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>02_03_0105 -
           15254959-15255216,15256235-15256299,15257080-15257215,
           15257314-15257419,15257642-15257792,15258817-15258881,
           15258980-15259134,15259219-15259281,15259846-15259917,
           15260364-15260408
          Length = 371

 Score =  113 bits (273), Expect = 1e-25
 Identities = 59/123 (47%), Positives = 75/123 (60%), Gaps = 1/123 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  + GQTREH LL
Sbjct: 26  FETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYERGGQTREHVLL 85

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYN-PAAVAFVPISGWHG 616
           A TLGV +L+V +NKMD +   +      +   K     K  GYN    V F+PISG  G
Sbjct: 86  AKTLGVSKLVVVINKMDESTVGWSKERYDEIEGKMVPFLKSSGYNVKKDVHFLPISGLLG 145

Query: 617 DNM 625
            NM
Sbjct: 146 TNM 148


>04_04_1593 -
           34661670-34661798,34661882-34661989,34662129-34662368,
           34662614-34662782,34662872-34663362,34663681-34663991,
           34664396-34664473,34665034-34665228,34665363-34665524,
           34665759-34665840
          Length = 654

 Score =  111 bits (266), Expect = 7e-25
 Identities = 54/125 (43%), Positives = 79/125 (63%), Gaps = 2/125 (1%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN--GQTREHA 433
           F+T  Y+V ++D+PGH+DF+ NMI+G +Q+D A+L++ A  G FEAG+  N  GQT+EH+
Sbjct: 307 FDTKNYHVVLLDSPGHKDFVPNMISGATQSDAAILVIDASIGSFEAGMGINGIGQTKEHS 366

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            L  + GV  LIV VNKMDS E  Y        + +     +  GY  +AVA+VPIS   
Sbjct: 367 QLVRSFGVDNLIVVVNKMDSVE--YSKERFNFIKSQLGAFLRSCGYKDSAVAWVPISAME 424

Query: 614 GDNML 628
            +N++
Sbjct: 425 NENLM 429



 Score = 31.5 bits (68), Expect = 0.71
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = +1

Query: 169 MGKGSFKYAWVLDKLKAERE 228
           +GKGSF YAW +D+   ERE
Sbjct: 276 IGKGSFAYAWAMDESADERE 295


>04_03_0107 +
           11328267-11328276,11329059-11329170,11329862-11329907,
           11330185-11330256,11332292-11332303,11332880-11332942,
           11333038-11333192,11333303-11333367,11334645-11334795,
           11335230-11335335,11335440-11335575,11336310-11336374,
           11337003-11337188,11337298-11337399
          Length = 426

 Score =  107 bits (258), Expect = 7e-24
 Identities = 62/137 (45%), Positives = 77/137 (56%), Gaps = 5/137 (3%)
 Frame = +2

Query: 260 FETSKYYVTIIDAP----GHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           FET     TI+DAP    GH+ ++ NMI+G SQAD  VL+++A  GEFE G  K GQTRE
Sbjct: 67  FETETTRFTILDAPVKMKGHKSYVPNMISGASQADIGVLVISARKGEFETGYEKGGQTRE 126

Query: 428 HALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYN-PAAVAFVPIS 604
           H LLA TLGV +LIV +NKMD     +      +   K     +  GYN    V F+PIS
Sbjct: 127 HVLLAKTLGVAKLIVVINKMDEPTVKWSKERYDEIESKMVPFLRSSGYNVKKDVHFLPIS 186

Query: 605 GWHGDNMLELQPKCLGS 655
           G  G NM     K + S
Sbjct: 187 GLLGSNMKTRMDKSICS 203



 Score = 51.2 bits (117), Expect = 8e-07
 Identities = 21/51 (41%), Positives = 36/51 (70%)
 Frame = +1

Query: 73  DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           D+GKST  G +++  G +D RTI+K+EKEA++  + S+  A+++D  + ER
Sbjct: 4   DAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDTNEEER 54


>04_04_1015 -
           30115377-30115477,30115570-30115615,30116491-30116590,
           30116676-30116771,30119519-30119556,30119623-30119733,
           30119820-30119951,30120024-30120263,30120532-30120700,
           30120994-30121493,30121581-30121691,30121802-30122133,
           30122603-30122737,30122839-30122988,30123809-30123947
          Length = 799

 Score =  100 bits (239), Expect = 1e-21
 Identities = 51/129 (39%), Positives = 78/129 (60%), Gaps = 5/129 (3%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN-----GQTRE 427
           ET KY V ++D+PGH+DF+ NMI+G +QAD A+L+V A TG FEAG+        GQT+E
Sbjct: 321 ETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSFEAGMDGEGGKSVGQTKE 380

Query: 428 HALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISG 607
           HA L  + GV+QLIV VNKMD+    Y        + +     +   +  ++V ++P+S 
Sbjct: 381 HAQLIRSFGVEQLIVAVNKMDAI--GYSKERFEFIKVQLGSFLRSCNFKDSSVTWIPLSA 438

Query: 608 WHGDNMLEL 634
               N++++
Sbjct: 439 VENQNLIKI 447



 Score = 79.0 bits (186), Expect = 4e-15
 Identities = 33/63 (52%), Positives = 46/63 (73%)
 Frame = +1

Query: 40  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 219
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   
Sbjct: 246 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSE 305

Query: 220 ERE 228
           ERE
Sbjct: 306 ERE 308


>04_04_1008 -
           30054674-30054774,30054867-30054912,30055788-30055887,
           30055973-30056068,30058816-30058853,30058920-30059030,
           30059117-30059248,30059321-30059560,30059829-30059997,
           30060291-30060790,30060878-30060988,30061099-30061430,
           30061900-30062034,30062136-30062285,30063106-30063244
          Length = 799

 Score =  100 bits (239), Expect = 1e-21
 Identities = 51/129 (39%), Positives = 78/129 (60%), Gaps = 5/129 (3%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN-----GQTRE 427
           ET KY V ++D+PGH+DF+ NMI+G +QAD A+L+V A TG FEAG+        GQT+E
Sbjct: 321 ETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSFEAGMDGEGGKSVGQTKE 380

Query: 428 HALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISG 607
           HA L  + GV+QLIV VNKMD+    Y        + +     +   +  ++V ++P+S 
Sbjct: 381 HAQLIRSFGVEQLIVAVNKMDAI--GYSKERFEFIKVQLGSFLRSCNFKDSSVTWIPLSA 438

Query: 608 WHGDNMLEL 634
               N++++
Sbjct: 439 VENQNLIKI 447



 Score = 79.0 bits (186), Expect = 4e-15
 Identities = 33/63 (52%), Positives = 46/63 (73%)
 Frame = +1

Query: 40  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 219
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   
Sbjct: 246 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSE 305

Query: 220 ERE 228
           ERE
Sbjct: 306 ERE 308


>03_06_0699 -
           35612919-35612989,35613079-35613319,35613506-35613568,
           35613644-35613709,35614110-35614193,35614685-35614890,
           35614977-35615067,35615176-35615280,35615552-35615626,
           35615728-35615820,35615914-35615989,35616115-35616305
          Length = 453

 Score = 70.9 bits (166), Expect = 9e-13
 Identities = 34/83 (40%), Positives = 52/83 (62%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET+K +   +D PGH D++KNMITG +Q D  +L+V+A  G          QT+EH L
Sbjct: 124 EYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMP-------QTKEHIL 176

Query: 437 LAFTLGVKQLIVGVNKMDSTEPP 505
           LA  +GV  L+  +NK+D+ + P
Sbjct: 177 LARQVGVPSLVCFLNKVDAVDDP 199



 Score = 34.7 bits (76), Expect = 0.076
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 180
           + K H+N+  IGHVD GK+T T     ++ + G       ++ +K  +E  +G
Sbjct: 63  RTKPHVNVGTIGHVDHGKTTLTAAITKVLAEAGKAKAVAFDEIDKAPEEKARG 115


>02_04_0462 + 23131433-23132836
          Length = 467

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 32/81 (39%), Positives = 49/81 (60%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET   +   +D PGH D++KNMITG +Q D A+L+V+   G          QT+EH L
Sbjct: 127 EYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMP-------QTKEHIL 179

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           LA  +GV +++V +NK D  +
Sbjct: 180 LAKQVGVPKIVVFLNKKDQVD 200



 Score = 37.5 bits (83), Expect = 0.011
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +1

Query: 22  KMGKEKTHINIVVIGHVDSGKSTTTGHL---IYKCGGIDKRTIEKFEKEAQEMGKG 180
           K  + K H+NI  IGHVD GK+T T  L   +   GG   +  ++ +   +E  +G
Sbjct: 63  KFERTKPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYDEIDAAPEERARG 118


>12_01_0491 -
           3884764-3885114,3885143-3885403,3885493-3885711,
           3885792-3886019,3886378-3886480,3886703-3886815,
           3887262-3887323,3887915-3888104
          Length = 508

 Score = 35.9 bits (79), Expect = 0.033
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +V+ +D PGH   +  M+ G +  D A+L++AA             QT EH      + +
Sbjct: 149 HVSFVDCPGHDILMATMLNGAAIMDGALLLIAANES------CPQPQTSEHLAAVEIMRL 202

Query: 458 KQLIVGVNKMD 490
           + +I+  NK+D
Sbjct: 203 QHIIILQNKID 213


>06_01_0325 -
           2366193-2366367,2367063-2367122,2367323-2367463,
           2368175-2368288,2368444-2368475,2368736-2368793,
           2369263-2369434,2369584-2370334,2370743-2371036
          Length = 598

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 27/93 (29%), Positives = 41/93 (44%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           +   Y + +ID PGH DF   +    +    A+L+V A  G          QT  +  LA
Sbjct: 130 DAPSYLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQG-------VQAQTIANFYLA 182

Query: 443 FTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRK 541
           F   +  +I  +NK+D    P   PD  K++ K
Sbjct: 183 FESNL-SIIPVINKIDQ---PTADPDNVKAQLK 211



 Score = 27.9 bits (59), Expect = 8.7
 Identities = 13/28 (46%), Positives = 15/28 (53%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 132
           N  +I HVD GKST    L+   G I K
Sbjct: 59  NFSIIAHVDHGKSTLADRLLELTGTIKK 86


>09_04_0730 +
           19783346-19783372,19783548-19783638,19783973-19784051,
           19784410-19784743,19784934-19785968,19786141-19786290,
           19786781-19787215
          Length = 716

 Score = 32.7 bits (71), Expect = 0.31
 Identities = 22/72 (30%), Positives = 31/72 (43%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T +D PGH  F      G +  D  VL+VAA  G     +    +   HA  A      
Sbjct: 247 ITFLDTPGHAAFSAMRARGAAVTDIVVLVVAADDGVMPQTL----EAMSHAKAANV---- 298

Query: 461 QLIVGVNKMDST 496
            ++V VNK D +
Sbjct: 299 PIVVAVNKCDKS 310


>06_03_0715 -
           23823427-23823525,23823616-23823822,23823907-23824017,
           23824124-23824322,23824410-23824495,23824940-23825098,
           23825204-23825302,23825385-23826578,23826666-23826734,
           23828042-23828812
          Length = 997

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 16/37 (43%), Positives = 19/37 (51%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           Y   I+D PGH +F   M      AD AVL+V A  G
Sbjct: 219 YLCNIMDTPGHVNFSDEMTAALRIADGAVLVVDAAEG 255


>03_05_0044 +
           20203644-20204054,20204695-20204916,20205092-20205130,
           20206275-20206396,20206489-20206639,20207892-20207963,
           20208256-20208351,20208861-20208949,20209068-20209134,
           20210197-20210235,20210369-20210429,20210572-20210681,
           20210766-20210840,20210914-20210982,20213126-20213247,
           20214682-20214807,20214897-20215017,20215133-20215233,
           20215564-20215624,20216560-20216613,20217585-20217689
          Length = 770

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           Y V IID PGH DF   +       D A+L++ +  G     I+ + Q R + +
Sbjct: 136 YQVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEI 189



 Score = 29.5 bits (63), Expect = 2.9
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGI 126
           NI +  H+DSGK+T T  ++Y  G I
Sbjct: 70  NIGISAHIDSGKTTLTERVLYYTGRI 95


>03_05_0511 + 25056018-25059107
          Length = 1029

 Score = 31.9 bits (69), Expect = 0.54
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           N  ++ HVD GK+T   HL+  CG
Sbjct: 12  NTCILAHVDHGKTTLADHLVASCG 35



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           V +ID+PGH DF   + +    +D A+++V A  G
Sbjct: 77  VNLIDSPGHIDFCSEVSSAARLSDSALILVDAVEG 111


>02_04_0148 - 20198407-20201424
          Length = 1005

 Score = 31.5 bits (68), Expect = 0.71
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           V +ID+PGH DF   +      AD A+++V A  G
Sbjct: 89  VHLIDSPGHIDFCSEVSAAARLADSALVLVDAAEG 123



 Score = 29.1 bits (62), Expect = 3.8
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEM 171
           N  ++ HVD GK++   HLI   G  ++R  E+    A+ M
Sbjct: 18  NTCILAHVDHGKTSLADHLIAAYGS-ERRVSERMAGSARVM 57


>01_06_0734 +
           31569017-31569358,31569832-31569906,31570009-31570159,
           31570716-31570784,31570864-31571036,31571474-31571611,
           31571747-31571872,31571951-31572049,31573175-31573298,
           31573465-31573528,31573798-31573852,31573951-31574075,
           31574228-31574301,31574436-31574485,31574722-31574808,
           31574897-31574947,31575025-31575108,31575400-31575498
          Length = 661

 Score = 31.5 bits (68), Expect = 0.71
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           N+ VI HVD GK+T    L+ +CG
Sbjct: 66  NVAVIAHVDHGKTTLMDRLLRQCG 89



 Score = 29.1 bits (62), Expect = 3.8
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           + ++D PGH DF   +       + AVL+V AG G
Sbjct: 125 LNMVDTPGHADFGGEVERVVGMVEGAVLVVDAGEG 159


>04_04_0640 -
           26891552-26891725,26891814-26892326,26892698-26893644,
           26893778-26894114,26894413-26894462,26895020-26895248
          Length = 749

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 12/26 (46%), Positives = 20/26 (76%)
 Frame = +1

Query: 43  HINIVVIGHVDSGKSTTTGHLIYKCG 120
           HI+ V++ H+D+GK+TTT  ++Y  G
Sbjct: 105 HIS-VIMAHIDAGKTTTTERVLYYTG 129


>04_01_0103 + 1082077-1082167,1083037-1085477
          Length = 843

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K+    N+ VI HVD GKST T  L+   G
Sbjct: 13  MDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAG 44



 Score = 29.5 bits (63), Expect = 2.9
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +2

Query: 269 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>02_04_0017 + 18937774-18937864,18938505-18940945
          Length = 843

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K+    N+ VI HVD GKST T  L+   G
Sbjct: 13  MDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAG 44



 Score = 29.5 bits (63), Expect = 2.9
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +2

Query: 269 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>02_01_0432 -
           3144560-3144655,3144792-3144832,3145019-3145094,
           3145465-3145542,3146121-3146208,3146613-3146686,
           3147445-3147579,3147699-3147770,3148239-3148325,
           3148418-3148522,3149028-3149085,3149576-3149634,
           3149960-3150056,3150217-3150317,3150443-3150487,
           3150619-3150681,3151082-3151147,3151286-3151342,
           3151570-3151656,3152063-3152239,3152413-3152625
          Length = 624

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 2/87 (2%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLG 454
           Y + +ID PGH DF   +    +  + A+L+V A  G  EA      QT  +  LA    
Sbjct: 143 YCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQG-VEA------QTLANVYLALEND 195

Query: 455 VKQLIVGVNKMD--STEPPYVSPDLRK 529
           + ++I  +NK+D    EP  V+ ++ +
Sbjct: 196 L-EIIPVLNKIDLPGAEPDRVAQEIEE 221



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 147
           N  +I H+D GKST    L+   G + KR +++
Sbjct: 79  NFSIIAHIDHGKSTLADKLLELTGTVQKREMKQ 111


>01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912
          Length = 853

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K+    N+ VI HVD GKST T  L+   G
Sbjct: 13  MDKKDNIRNMSVIAHVDHGKSTLTDSLVAAAG 44



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           K + + Y + +ID+PGH DF   +       D A+++V
Sbjct: 92  KRDGNSYLINLIDSPGHIDFSSEVTAALRITDGALVVV 129


>01_05_0487 +
           22641133-22642182,22642276-22642863,22642961-22643068,
           22643582-22643692,22643784-22643849,22644858-22644917,
           22644990-22645119,22645159-22645547,22645783-22645902,
           22645957-22646022,22646190-22646255
          Length = 917

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIV 370
           +ID PGH+ F      G+S  D A+L+V
Sbjct: 489 VIDTPGHQSFSNLRTRGSSLCDIAILVV 516


>12_02_0457 +
           19239816-19241319,19241337-19241632,19241729-19241829,
           19241939-19242029,19242158-19242268,19242360-19242425,
           19242457-19242462
          Length = 724

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 23/68 (33%), Positives = 33/68 (48%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           +ID PGH  F      G S  D AV++V     +   G+ K  QT E   L     V+ +
Sbjct: 507 VIDTPGHESFSNMRSRGMSLCDIAVVVV-----DIMHGLEK--QTVETLALLKDRNVRFI 559

Query: 467 IVGVNKMD 490
           +V +NK+D
Sbjct: 560 VV-LNKVD 566


>01_06_0662 + 30987187-30987277,30987825-30990214
          Length = 826

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K+    N+ V+ HVD GKST T  L+   G
Sbjct: 13  MDKKHNIRNMSVVAHVDHGKSTLTDSLVAAAG 44



 Score = 29.5 bits (63), Expect = 2.9
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +2

Query: 269 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>05_07_0329 -
           29308867-29308932,29309040-29309159,29309245-29309364,
           29309566-29310123,29310199-29310258,29310839-29310904,
           29310993-29311103,29311167-29311257,29311349-29311449,
           29311534-29311641,29311737-29314205
          Length = 1289

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIV 370
           +ID PGH  F      G+S  D A+L+V
Sbjct: 766 VIDTPGHESFSNLRSRGSSLCDIAILVV 793


>03_04_0151 - 17729023-17729372,17729441-17730623,17730723-17730953,
            17730975-17731036,17732085-17732157,17737044-17737834,
            17737932-17738004
          Length = 920

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 16/53 (30%), Positives = 23/53 (43%)
 Frame = -1

Query: 511  HVWWFSGIHFVYSYDELFDTEGESEQGMLTGLTVLRDTSFEFTGTGSYDEHSA 353
            H W FS    +Y Y E        +Q ++T +T +  T+   T    Y  HSA
Sbjct: 862  HEWAFSVAENIYDYKEPSHWHERQQQKLVTSITKIGKTTAITTRDTYYSYHSA 914


>12_02_1094 +
           26032135-26032164,26032975-26033152,26033234-26034017,
           26034135-26034216,26034968-26035177
          Length = 427

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = +2

Query: 422 REHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHT 553
           RE A L   LG   +    +K D  E P  SP+ R   R  PH+
Sbjct: 258 REIAALGLQLGKMNIASWASKDDDDELPRASPEKRPRPRPRPHS 301


>04_03_0961 +
           21263735-21263773,21264157-21264279,21266774-21266847,
           21266939-21267095,21267554-21267694,21267739-21267823,
           21268810-21268903,21269041-21269239,21269515-21269549,
           21270076-21270631,21270722-21270882,21271704-21271718,
           21273078-21273330,21273439-21273562,21273688-21273788,
           21274870-21274938,21275060-21275191,21275270-21275404,
           21275489-21275551,21275636-21275881,21276007-21276285
          Length = 1026

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 11/34 (32%), Positives = 22/34 (64%), Gaps = 4/34 (11%)
 Frame = +1

Query: 514 PRFEEIKKE----VSSYIQEDWLQPSCCRFRAHF 603
           P  EE +++    V++ + E W++ SCC+++A F
Sbjct: 520 PAIEEHERDSQDSVATSLAEKWIEASCCKYKADF 553


>01_01_1168 - 9305084-9307172,9307751-9308460,9308624-9308821
          Length = 998

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 18/67 (26%), Positives = 32/67 (47%)
 Frame = +1

Query: 88  TTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAEREXVSQSILLSEVRN 267
           T +G+++ KCGG+    +      AQ   K   ++  V D+L +    +S S ++  +R 
Sbjct: 388 TISGNILAKCGGLPLAIVSVGGMLAQAENKTPAEWMKVCDRLGSR---LSTSAMMERMRR 444

Query: 268 *QVLCYH 288
              L YH
Sbjct: 445 IMSLSYH 451


>01_01_0016 - 88825-90411
          Length = 528

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -1

Query: 472 YDELFDTEGESEQGMLTGLTVLRDTSFEFTGTGSYDEHSA 353
           YD  F     + +G+L  L+V+    F+ TGT + D+H A
Sbjct: 241 YDAAF--RDHARRGLLPALSVIEPRYFDLTGTPADDDHPA 278


>05_04_0116 + 18131510-18133192
          Length = 560

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 23/62 (37%), Positives = 30/62 (48%), Gaps = 4/62 (6%)
 Frame = -2

Query: 519 SGLTYGGSVE-SILFTPTMSCLTPRVKASKACSRV*PFLEIPASNSPVPA---ATMSTAQ 352
           SG   GGS+  S+   P  S  T  V  S       P +  PA+ +P PA   ATM+ AQ
Sbjct: 69  SGEGQGGSMSLSLQLRPLGSTPTAAVAVSVPPMAAAPMMAGPAAAAPAPAPPLATMAVAQ 128

Query: 351 SA 346
           +A
Sbjct: 129 NA 130


>04_03_0320 - 14316934-14318550
          Length = 538

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = -1

Query: 289 DGNIVLASFE-LPRAISIVIPXHAQPLVCPIPKHI*RILYPFPGPPSRTSRWYVCQ 125
           DG +++ S +  PR + I  P     L  P P+   ++L P P PP R +  +V +
Sbjct: 135 DGRVLVESPDRAPRRLGINTPYRYTVLRPPHPRESVQLLPPLPPPPGRGAGKHVVE 190


>04_03_1034 -
           21865633-21865811,21865838-21865860,21866345-21866433,
           21872484-21872894,21872968-21873284,21873389-21873467,
           21873539-21873903,21874484-21874656,21874824-21874913,
           21875797-21875862,21876615-21876661
          Length = 612

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/52 (28%), Positives = 24/52 (46%)
 Frame = +1

Query: 109 YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAEREXVSQSILLSEVR 264
           Y C  ++  + E+F      + +G +       KLK  RE V ++I  S VR
Sbjct: 388 YLCDFLEMTSKEEFSSSLSTVRRGHYGLVHTAVKLKILRELVDEAITTSAVR 439


>04_04_1357 +
           32860677-32860781,32861484-32861588,32861678-32861728,
           32861829-32861949,32862495-32862616,32863032-32863133,
           32863226-32863300,32863391-32863470,32863601-32863751,
           32863850-32864080,32864221-32864517,32864638-32864751,
           32864857-32865030
          Length = 575

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 21/62 (33%), Positives = 25/62 (40%), Gaps = 3/62 (4%)
 Frame = +2

Query: 485 MDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPA---AVAFVPISGWHGDNMLELQPKCLGS 655
           M+    PYV   L+KS+ KY         NP       FV   G H   MLE+      S
Sbjct: 458 MNGKSDPYVVLSLKKSKTKYKTRVVSESLNPVWNQTFDFVVEDGLHDMLMLEVYDHDTFS 517

Query: 656 RD 661
           RD
Sbjct: 518 RD 519


>04_04_0214 -
           23674270-23676858,23677574-23680843,23680941-23681119,
           23681200-23681559,23681645-23682086,23682199-23682332,
           23682479-23682680
          Length = 2391

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = +2

Query: 170 WVKDPSNMLGYWTN*RLSVXRYHNR 244
           W+  PS+ +GYW N  +S   + N+
Sbjct: 876 WISSPSSGVGYWGNSEMSQRTFFNQ 900


>04_03_0106 +
           11325172-11325379,11326590-11326640,11326987-11327073,
           11327276-11327373
          Length = 147

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSG 81
           K H+N+V IGHVD G
Sbjct: 104 KRHLNVVFIGHVDPG 118


>03_05_0339 +
           23287620-23287676,23287784-23287849,23287937-23288048,
           23288240-23288368,23288795-23288866,23289245-23289360,
           23289494-23289570,23289788-23290273,23290373-23290688,
           23290769-23290915
          Length = 525

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = -1

Query: 403 DTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLA 269
           D    F+G  +  +   I LRG+ +HVLDE    RS++D   VL+
Sbjct: 350 DKLIHFSGV-AMGQACTIVLRGASEHVLDE--AERSLHDALCVLS 391


>03_02_0712 -
           10600147-10600196,10600257-10600378,10600993-10601489,
           10601663-10601851,10601936-10602099,10602193-10602446,
           10602535-10602691,10602830-10602995,10603121-10603227,
           10603305-10603478,10603594-10603689,10603781-10603862,
           10603948-10604058,10604253-10604309,10604638-10604709,
           10604799-10605041,10605195-10605341,10605381-10605616,
           10605745-10605865
          Length = 1014

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 3/78 (3%)
 Frame = +1

Query: 43  HINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           ++ I   G   SGK+ T     ++  +  G++ R +    K A++  KG+F Y   +  +
Sbjct: 465 NVCIFAYGQTGSGKTYTMSGPKNMTEQTQGVNYRALSDLFKLAEQR-KGAFIYDIAVQMI 523

Query: 214 KAEREXVSQSILLSEVRN 267
           +   E V   ++  E+RN
Sbjct: 524 EIYNEQVRDLLVNDEIRN 541


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,150,023
Number of Sequences: 37544
Number of extensions: 437345
Number of successful extensions: 1216
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 1146
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1204
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1909952136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -