SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30098.Seq
         (617 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0934 - 12513810-12513834,12513918-12513970,12514212-125145...   136   1e-32
03_05_0125 - 21039767-21039791,21039876-21039922,21040220-210405...   135   2e-32
07_03_1639 + 28305801-28305958,28306240-28306249                       37   0.011
07_03_0435 + 18182657-18183509,18184477-18184574,18184663-181848...    35   0.059
12_02_1042 + 25638585-25638711,25639585-25639745,25639873-256400...    33   0.14 
02_04_0038 - 19110520-19110574,19110684-19110811,19110912-191110...    33   0.14 
03_02_0596 + 9714022-9714065,9714799-9714868,9714978-9715883,971...    29   3.0  
04_04_1687 - 35365766-35366356,35367137-35368135                       29   3.9  
04_04_1503 + 34031540-34031562,34031682-34032212,34032417-340325...    29   3.9  
01_05_0450 + 22357006-22357323,22357365-22357713,22358175-22358416     29   3.9  
04_03_0266 + 13648287-13649099,13649186-13649524                       28   5.2  
04_01_0525 - 6886920-6887298,6888650-6888882                           28   5.2  
03_02_0050 + 5272471-5274861                                           28   5.2  
10_06_0028 - 9802362-9802475,9802919-9803090,9803167-9803208,980...    28   6.8  
02_05_1331 + 35736543-35736638,35737407-35737525,35737670-357377...    28   6.8  
02_05_0521 - 29726985-29727605                                         28   6.8  
02_02_0421 - 10042184-10042197,10042442-10042822,10044158-100442...    28   6.8  
12_01_0476 + 3738526-3738567,3738695-3738739,3739240-3739601,373...    27   9.0  
10_08_0781 + 20509033-20509714,20510048-20510191,20510604-205107...    27   9.0  
08_01_0397 - 3509186-3510291,3510322-3512335                           27   9.0  
02_05_0067 + 25557975-25558553                                         27   9.0  
02_03_0300 + 17454622-17455402,17455535-17456977,17457015-174573...    27   9.0  

>03_02_0934 -
           12513810-12513834,12513918-12513970,12514212-12514525,
           12514608-12514730,12515710-12515821
          Length = 208

 Score =  136 bits (330), Expect = 1e-32
 Identities = 60/84 (71%), Positives = 73/84 (86%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M SLKLQKRLAASV++CGK KVWLDPNE+NEI+  NSRQNIRK++KDG +IKKP  +HSR
Sbjct: 1   MVSLKLQKRLAASVLKCGKGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIKKPQKIHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGT 252
           +R R+  EA++KGRH G+GKRRGT
Sbjct: 61  SRARRAHEAKQKGRHSGYGKRRGT 84



 Score =   99 bits (238), Expect = 1e-21
 Identities = 48/84 (57%), Positives = 56/84 (66%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKK 437
           AR+P K LW                AKKID+H+YH +YMK KGN+FKNKRVLME IH+ K
Sbjct: 87  ARLPTKILWMRRMRVLRRLLRKYREAKKIDKHMYHDMYMKVKGNMFKNKRVLMESIHKSK 146

Query: 438 AEKARTKMLSDQAEARRNKVKEAR 509
           AEKAR K LSDQ EA+R K K +R
Sbjct: 147 AEKAREKTLSDQFEAKRAKSKASR 170


>03_05_0125 -
           21039767-21039791,21039876-21039922,21040220-21040533,
           21040613-21040735,21041599-21041710
          Length = 206

 Score =  135 bits (327), Expect = 2e-32
 Identities = 59/84 (70%), Positives = 73/84 (86%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M SLKLQKRLA+SV++CGK KVWLDPNE+NEI+  NSRQNIRK++KDG +IKKP  +HSR
Sbjct: 1   MVSLKLQKRLASSVLKCGKGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIKKPQKIHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGT 252
           +R R+  EA++KGRH G+GKRRGT
Sbjct: 61  SRARRAHEAKQKGRHSGYGKRRGT 84



 Score =   99 bits (238), Expect = 1e-21
 Identities = 48/84 (57%), Positives = 56/84 (66%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKK 437
           AR+P K LW                AKKID+H+YH +YMK KGN+FKNKRVLME IH+ K
Sbjct: 87  ARLPTKILWMRRMRVLRRLLRKYREAKKIDKHMYHDMYMKVKGNMFKNKRVLMESIHKSK 146

Query: 438 AEKARTKMLSDQAEARRNKVKEAR 509
           AEKAR K LSDQ EA+R K K +R
Sbjct: 147 AEKAREKTLSDQFEAKRAKSKASR 170


>07_03_1639 + 28305801-28305958,28306240-28306249
          Length = 55

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 20/41 (48%), Positives = 25/41 (60%)
 Frame = +3

Query: 372 MKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNK 494
           MK KGN+  NKR       + +AEKAR + LSDQ EA+  K
Sbjct: 1   MKVKGNMLNNKRGPYGEYPQVQAEKARKRTLSDQFEAKLAK 41


>07_03_0435 +
           18182657-18183509,18184477-18184574,18184663-18184833,
           18185524-18185624,18185702-18185837,18186007-18186057,
           18186202-18186489,18186610-18186844,18186924-18187204,
           18187336-18187557
          Length = 811

 Score = 34.7 bits (76), Expect = 0.059
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = +3

Query: 429 RKKAEKARTKMLSDQAEARRNKVKEARSA 515
           RKKAE+A  K  +++AEARR K +E R A
Sbjct: 208 RKKAEEAEAKRKAEEAEARRKKEEEERDA 236


>12_02_1042 +
           25638585-25638711,25639585-25639745,25639873-25640064,
           25640221-25640315,25640645-25640807,25640905-25641015,
           25641611-25642741,25642813-25642965,25643060-25643159,
           25643333-25643427,25643508-25643681,25643751-25643807,
           25643887-25643958,25644151-25644249,25644320-25644451,
           25644549-25644722,25644830-25644957,25645065-25645119
          Length = 1072

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 3/77 (3%)
 Frame = +1

Query: 16  LQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMI---KDGLVIKKPVAVHSRAR 186
           LQ+ L     +  K   W D  E+N +   + R +  KM+    D LV+   +A H    
Sbjct: 748 LQQFLVTIFDKLDKGNPWDDDFELNTLLQESIRNSADKMLLTAPDSLVVS--LAKHDTRN 805

Query: 187 VRKNTEARRKGRHCGFG 237
             + T   RKGR  GFG
Sbjct: 806 DEETTSISRKGRAQGFG 822


>02_04_0038 -
           19110520-19110574,19110684-19110811,19110912-19111085,
           19111189-19111320,19111391-19111489,19111680-19111751,
           19111831-19111887,19111957-19112130,19112211-19112305,
           19112478-19112577,19112672-19112824,19112896-19114026,
           19114621-19114731,19114829-19114991,19115364-19115458,
           19115613-19115804,19115929-19116069
          Length = 1023

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 3/77 (3%)
 Frame = +1

Query: 16  LQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMI---KDGLVIKKPVAVHSRAR 186
           LQ+ L     +  K   W D  E+N +   + R +  KM+    D LV+   +A H    
Sbjct: 699 LQQFLVTIFDKLDKGNPWDDDFELNTLLQESIRNSADKMLLTAPDSLVVS--LAKHDTRN 756

Query: 187 VRKNTEARRKGRHCGFG 237
             + T   RKGR  GFG
Sbjct: 757 DEETTSISRKGRAQGFG 773


>03_02_0596 +
           9714022-9714065,9714799-9714868,9714978-9715883,
           9715973-9716146,9716260-9716373,9716975-9717033,
           9717170-9717236,9717305-9717356,9718070-9718488,
           9718786-9718847,9719305-9719374,9719730-9719831,
           9719933-9720063,9720492-9720606,9720792-9720827
          Length = 806

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 1/62 (1%)
 Frame = +1

Query: 85  INEIANTNSRQNIRKMIKDGLVIK-KPVAVHSRARVRKNTEARRKGRHCGFGKRRGTAMR 261
           + E  N NS +     +  GL+ + KP+ V S  RVR +     K      GK R TA  
Sbjct: 198 LGEANNDNSEKLEELFLDKGLLDELKPIRVESGKRVRASIRIIEKMMSSRVGKIRNTAND 257

Query: 262 VC 267
           +C
Sbjct: 258 MC 259


>04_04_1687 - 35365766-35366356,35367137-35368135
          Length = 529

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 10/18 (55%), Positives = 11/18 (61%)
 Frame = +3

Query: 150 HQETCSSPLPRPCPQKHR 203
           H E C +PLP P P  HR
Sbjct: 53  HAEQCPAPLPDPLPSAHR 70


>04_04_1503 +
           34031540-34031562,34031682-34032212,34032417-34032571,
           34032929-34033020,34033916-34034419
          Length = 434

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 3/61 (4%)
 Frame = +3

Query: 432 KKAEKAR--TKMLSDQAEARRNKVKEARSAARNVL-PPRRRNCCRPSLEKTKPRLPLRSK 602
           +K  K R  T +  D+ +ARR+K +        +  PPRR    + +     PR+PL  +
Sbjct: 295 RKGNKQRMSTALDCDRTDARRSKTRGRNDRWMTIRGPPRRATRRQKNQLLNSPRVPLMGR 354

Query: 603 H 605
           H
Sbjct: 355 H 355


>01_05_0450 + 22357006-22357323,22357365-22357713,22358175-22358416
          Length = 302

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = +1

Query: 142 GLVIKKPVAVHSRARVRKNTEARRKGRHCGFGKRRGTA 255
           G+ +K+    H  +    +    R+GRH G+G+RR +A
Sbjct: 212 GITLKEDEKQHGTSSSAADGGGLRRGRHDGWGRRRSSA 249


>04_03_0266 + 13648287-13649099,13649186-13649524
          Length = 383

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +1

Query: 55  KKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNT 201
           K+K+ L  +E ++   T  R+  RK+ K   + KK  + H   ++RK++
Sbjct: 320 KRKLVLSDDEGDDAEKTRDRETTRKLPKQA-IPKKKTSSHPMPKIRKSS 367


>04_01_0525 - 6886920-6887298,6888650-6888882
          Length = 203

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 12/43 (27%), Positives = 24/43 (55%)
 Frame = +3

Query: 453 TKMLSDQAEARRNKVKEARSAARNVLPPRRRNCCRPSLEKTKP 581
           T    D+ + R+ + ++ R +++ +LPPRR +  +   E  KP
Sbjct: 131 TAAADDEGDRRQQQHEDGRKSSQYLLPPRRPSSLQKIPEDQKP 173


>03_02_0050 + 5272471-5274861
          Length = 796

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = -1

Query: 509 SCLLYFIAAGLSLVAKHLRPGLLSLLPVDVL-HEHTLVLEHI 387
           SCL   +     L  +HL P LLS +P+D L H H  +L H+
Sbjct: 91  SCLPSLVPLLPVLPYRHLLPLLLSFVPLDPLRHLHRHLLAHL 132


>10_06_0028 -
           9802362-9802475,9802919-9803090,9803167-9803208,
           9803344-9804011,9804098-9804418,9804495-9804833,
           9804856-9805109,9805300-9805510
          Length = 706

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = +1

Query: 70  LDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVH 174
           LDP  +NE    N R NI   IKD L  ++   +H
Sbjct: 628 LDPAVVNETTLKNDRANIVDYIKDCLFARQRQGLH 662


>02_05_1331 + 35736543-35736638,35737407-35737525,35737670-35737715,
            35738117-35738172,35738452-35738547,35738844-35738961,
            35739406-35739672,35740023-35740124,35740302-35740659,
            35740750-35740863,35741045-35741676,35741895-35742103,
            35742597-35742819,35743419-35743538,35743888-35743914,
            35744281-35745045,35745431-35748511
          Length = 2142

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 21/68 (30%), Positives = 31/68 (45%)
 Frame = +3

Query: 333  AKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARS 512
            AK   + LY   + K   +  ++ R  +  IHR  AEK    MLS +   R + +K    
Sbjct: 847  AKPKWKPLYTIFHKKNPRSRREDLRTHVANIHRMIAEKIWPGMLSRKPVLRLHFLKFIDE 906

Query: 513  AARNVLPP 536
              R +LPP
Sbjct: 907  TCRQILPP 914


>02_05_0521 - 29726985-29727605
          Length = 206

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 18/59 (30%), Positives = 28/59 (47%)
 Frame = +1

Query: 112 RQNIRKMIKDGLVIKKPVAVHSRARVRKNTEARRKGRHCGFGKRRGTAMRVCHRRNYGY 288
           R  +R M++ GL  +  +AV   A  R + EARR+ R     +RR   M      N+ +
Sbjct: 54  RAAVRGMVRGGLAPRARLAVLRAAAFRDSREARRRIRRDRRRRRRRGMMVAALSPNHAF 112


>02_02_0421 -
           10042184-10042197,10042442-10042822,10044158-10044261,
           10044634-10044734,10044806-10045147,10045981-10046158,
           10047696-10047776,10049190-10049449
          Length = 486

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 18/72 (25%), Positives = 31/72 (43%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           + SL L  R+      C   +V+ D    +   N    +NIRK   + ++++ P+A   +
Sbjct: 103 IESLSLMIRMLL-YCECFAARVYCDGCHCSPCGNKIENENIRKEAIETILLRNPLAFQPK 161

Query: 181 ARVRKNTEARRK 216
                NT   RK
Sbjct: 162 IENSPNTVTVRK 173


>12_01_0476 +
           3738526-3738567,3738695-3738739,3739240-3739601,
           3739691-3740057,3740490-3740555,3741630-3741743
          Length = 331

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
 Frame = +1

Query: 25  RLAASVMRCGKKKVWLDPNEINEIA--NTNSRQNIRKMIKDGLV 150
           R A    RC +    LDPNEI  ++     SR+ + +++  G++
Sbjct: 236 RFALHCRRCERDATPLDPNEIKHVSPYGITSREQVLEVVARGIL 279


>10_08_0781 +
           20509033-20509714,20510048-20510191,20510604-20510719,
           20511356-20511520,20511822-20512043,20512613-20512735
          Length = 483

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 16/58 (27%), Positives = 29/58 (50%)
 Frame = +1

Query: 67  WLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNTEARRKGRHCGFGK 240
           ++D N+  +  + +SR ++   ++ GL +K PV  +    VR   E    GR  G G+
Sbjct: 29  YVDGNDTEDCYSGSSRASLAGALRQGLNLKSPVLGYKTPNVR---ELYTLGRELGQGQ 83


>08_01_0397 - 3509186-3510291,3510322-3512335
          Length = 1039

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = +3

Query: 429 RKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRR 545
           R+K ++   K L ++ E RR ++KE +   R     +RR
Sbjct: 158 RQKKKEEEQKQLDEEMETRRRRIKEWQEMKRREEETKRR 196


>02_05_0067 + 25557975-25558553
          Length = 192

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 10/25 (40%), Positives = 13/25 (52%)
 Frame = -3

Query: 408 HACS*THYPSPSCRVSGIDACQSSW 334
           H C   H   P CR + +DA Q+ W
Sbjct: 148 HGCDKEHAYQPPCRPNVVDASQAVW 172


>02_03_0300 +
           17454622-17455402,17455535-17456977,17457015-17457317,
           17458429-17458519,17458623-17459757,17459998-17460077,
           17460449-17460533,17460614-17460705,17461079-17461147,
           17461227-17461263,17461351-17461433,17461695-17461840,
           17461868-17462138,17462245-17462281,17462428-17462721
          Length = 1648

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 1/55 (1%)
 Frame = +1

Query: 55  KKKVWLDPN-EINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNTEARRK 216
           K KVW  P  E+  +    +R + +K  +     +KP A   R RVRK TEA  K
Sbjct: 681 KPKVWSRPRKEVEPVGKPKARGHPKKQAEPD---EKPKA---RGRVRKTTEANGK 729


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,459,266
Number of Sequences: 37544
Number of extensions: 389797
Number of successful extensions: 1240
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 1196
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1237
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1490248872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -