SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30097.Seq
         (631 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_1370 - 32990002-32990244,32990950-32991943,32992019-329922...    50   1e-06
07_01_0629 - 4695778-4696077,4696242-4696406,4696497-4696673,469...    36   0.027
03_02_0100 + 5622360-5622524,5622603-5622701,5622979-5623044           32   0.33 
07_01_0292 - 2117212-2117326,2117402-2117527,2117654-2117791,211...    31   0.57 
06_03_0518 - 21685950-21686221,21686768-21686882                       31   0.57 
10_08_0050 + 14469879-14470072,14470620-14471094                       31   1.00 
02_04_0028 + 19027510-19027983,19028087-19028278,19028369-190285...    30   1.3  
09_06_0111 - 20924838-20924969,20925147-20925290,20925391-209254...    30   1.7  
08_01_0525 + 4564885-4565221,4565337-4565476,4565582-4565677,456...    30   1.7  
12_02_0625 - 21331209-21331273,21331364-21331555,21332348-213325...    29   2.3  
07_01_0511 + 3806475-3806876,3807914-3808039,3808120-3808193,380...    29   2.3  
05_01_0029 + 187769-188707,188971-189246,189978-190174,190263-19...    29   3.0  
10_02_0175 - 6207485-6207898                                           29   4.0  
09_01_0117 + 1808669-1809181,1810038-1810059,1810170-1810223,181...    29   4.0  
04_04_1487 - 33919654-33920399,33920676-33920817                       29   4.0  
04_04_1220 + 31843628-31844755                                         29   4.0  
03_04_0069 - 17022468-17023361                                         29   4.0  
08_01_0619 + 5412058-5413224,5413357-5413476,5413755-5413831,541...    28   5.3  
04_04_0726 + 27588225-27588685,27588768-27588895,27590523-27591016     28   5.3  
03_05_0799 + 27809301-27811550                                         28   5.3  
03_05_0355 - 23420410-23420548,23420643-23420794                       28   5.3  
02_01_0360 - 2594534-2594601,2594778-2594829,2594915-2595029,259...    28   5.3  
01_01_0937 - 7388230-7388283,7388957-7389091,7389201-7389365,738...    28   5.3  
10_08_0042 - 14383143-14383628,14383647-14384609,14384697-143864...    28   7.0  
05_07_0308 + 29115892-29116083,29116771-29116885,29116978-291170...    28   7.0  
05_04_0031 + 17353292-17354353                                         28   7.0  
04_04_0555 - 26210346-26211458,26211530-26211719,26211826-262119...    28   7.0  
01_06_0049 - 25953811-25954131,25954223-25954903                       28   7.0  
01_06_0040 - 25874308-25874611,25875743-25875822,25876764-258769...    28   7.0  
09_04_0466 - 17838344-17838631                                         27   9.3  
08_01_0333 + 2977397-2977648,2978416-2978784,2980108-2980169,298...    27   9.3  
07_03_0251 + 15831712-15832127,15832203-15832344,15832692-158330...    27   9.3  
03_03_0075 + 14280297-14280830                                         27   9.3  
02_02_0256 - 8362374-8363003                                           27   9.3  

>04_04_1370 -
           32990002-32990244,32990950-32991943,32992019-32992240,
           32993413-32993543
          Length = 529

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 23/36 (63%), Positives = 29/36 (80%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q+QADLLG PV+RP  +E+TALGAA  AG A+ VW
Sbjct: 446 MQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVW 481


>07_01_0629 -
           4695778-4696077,4696242-4696406,4696497-4696673,
           4697157-4697455,4697589-4697751,4697897-4698088,
           4698211-4698385,4698527-4698741,4698948-4699385
          Length = 707

 Score = 35.9 bits (79), Expect = 0.027
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +1

Query: 490 KSAC-ICTELSSAPSLRRRGVASGARSLQPSRPPRRASGD 606
           + AC + ++    PS RRRG   G R   P  P RR SGD
Sbjct: 15  RPACRVASQCGGRPSTRRRGAGGGPRRAVPQPPVRRPSGD 54


>03_02_0100 + 5622360-5622524,5622603-5622701,5622979-5623044
          Length = 109

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 17/63 (26%), Positives = 28/63 (44%)
 Frame = -3

Query: 614 GRVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALGA 435
           GRV PD R     GC +R  E   R  R   +++S ++Q    G   ++   + +  L  
Sbjct: 21  GRVEPDGRAASASGCLMRRSEGRRRPWRHLLKITSEEIQQVQQGFLTVQKFQVSTAILQI 80

Query: 434 AIV 426
            I+
Sbjct: 81  III 83


>07_01_0292 -
           2117212-2117326,2117402-2117527,2117654-2117791,
           2117904-2118323,2118421-2118591,2118701-2118880,
           2118988-2119140,2119226-2119384,2119841-2120152,
           2120285-2120452,2120851-2121050,2122207-2122589,
           2123244-2123625
          Length = 968

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 1/67 (1%)
 Frame = +3

Query: 351 GKSRQECIGRWAGYCRGPHTHCA-TCDNGRPQGCTFHHEGTNDWYTQ*ISLHLHRTEFCA 527
           G+S  EC  RW  +     +H A T    +    T   +G N+W    ++L  HRT F  
Sbjct: 369 GRSGAECESRWLNFDDPLISHNAWTAREEKRLILTVQQQGMNNWINIAVTLGTHRTPFQC 428

Query: 528 IPPSARS 548
           +    RS
Sbjct: 429 LVRYQRS 435


>06_03_0518 - 21685950-21686221,21686768-21686882
          Length = 128

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 24/94 (25%), Positives = 35/94 (37%), Gaps = 5/94 (5%)
 Frame = +1

Query: 358 AGRNVSAGGLGIVV----GHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSA 525
           AGR V A G G       G     RP         + + R R  G+P        E+ S+
Sbjct: 3   AGRRVLAAGAGCACLRASGRPGAVRPRRRELGLGKVDLARRRRQGLPLIITIAFIEMGSS 62

Query: 526 PSLRRRGVASGARSLQPSRP-PRRASGDTRPPAR 624
           P++    V +   +++   P P    G   PP R
Sbjct: 63  PTIATATVPTPTTAIRAKSPTPEEMGGRRGPPKR 96


>10_08_0050 + 14469879-14470072,14470620-14471094
          Length = 222

 Score = 30.7 bits (66), Expect = 1.00
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = -3

Query: 293 GWTDTKNEHVNAENQIELLQFCRRD 219
           G+T T ++  N+ N  E+L+FCRR+
Sbjct: 101 GFTSTSSDRSNSGNSSEMLRFCRRE 125


>02_04_0028 +
           19027510-19027983,19028087-19028278,19028369-19028545,
           19029568-19029663,19030487-19030618,19030950-19031008,
           19031234-19031321,19031433-19031693
          Length = 492

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = +1

Query: 508 TELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPP 618
           T+   + S        GA + QP RPP+   G TRPP
Sbjct: 18  TQRRESTSTSTAAAEGGAVASQPPRPPQPRPGTTRPP 54


>09_06_0111 -
           20924838-20924969,20925147-20925290,20925391-20925453,
           20925993-20926116,20926779-20927005,20927088-20927255,
           20927348-20927498,20927567-20927889
          Length = 443

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 3/79 (3%)
 Frame = +1

Query: 373 SAGGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICT---ELSSAPSLRRR 543
           +A    ++   +  +R A ++A RA  S        +PS S   C      S+A +LR R
Sbjct: 3   AAASSSLLAAASSSSRAAAVSARRAP-SASPAAAASLPSPSRASCAPPLRASAARTLRSR 61

Query: 544 GVASGARSLQPSRPPRRAS 600
            VAS A ++QP  P  R S
Sbjct: 62  VVASAAPAMQPP-PASRVS 79


>08_01_0525 +
           4564885-4565221,4565337-4565476,4565582-4565677,
           4566079-4566146,4566542-4566643,4567492-4567630,
           4567758-4567898,4568241-4568297,4568400-4568459,
           4568866-4568973,4569834-4569994,4570453-4570531,
           4571357-4571490,4571846-4571951,4572244-4572432,
           4572595-4572822,4573028-4573183,4573491-4573532,
           4573752-4573868,4573945-4574121
          Length = 878

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 17/58 (29%), Positives = 22/58 (37%)
 Frame = -2

Query: 600 RRAPWRTRWLQTARP*GNSSPTEGWRRTQFCADAG*FTGYTSHSSPHDGKYSPGGGHC 427
           R  PW       ++P  +  P     R+   AD    TG +   S H     PGG HC
Sbjct: 10  RGRPWHVLPSSPSQPPSSPPPRASADRSSAAADLDLGTGRSGEHSVHRVFLDPGGKHC 67


>12_02_0625 -
           21331209-21331273,21331364-21331555,21332348-21332558,
           21333600-21333700,21333839-21333844,21333956-21334051,
           21334485-21334497
          Length = 227

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 17/47 (36%), Positives = 21/47 (44%)
 Frame = -3

Query: 512 SVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPAD 372
           S  +QADLLG PVIRP           + AG  ++        PP D
Sbjct: 38  SAHLQADLLGSPVIRPSEPLELQKQLELAAGIWIKAVDPAFGLPPVD 84


>07_01_0511 +
           3806475-3806876,3807914-3808039,3808120-3808193,
           3808278-3808347,3808431-3808486,3808578-3808649,
           3808678-3808811,3808967-3809030,3809111-3809240,
           3809326-3809541,3809629-3809750,3810527-3810701,
           3810788-3810878,3811040-3811197,3811330-3811518,
           3813257-3813340,3813362-3813536,3815300-3815955,
           3816226-3816648,3816752-3816790
          Length = 1151

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 18/40 (45%), Positives = 21/40 (52%)
 Frame = -3

Query: 623 RAGGRVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQ 504
           RAG RV P A R GR G   R   A PR RR   E+  ++
Sbjct: 37  RAGKRVPPPAIR-GRKGAAGRRGGAAPRGRRKAVEVVDLE 75


>05_01_0029 + 187769-188707,188971-189246,189978-190174,190263-190404,
            190584-190862,190941-191013,191331-191379,192169-192433,
            192576-192631,192777-192845,193028-193139,193682-193771,
            193955-194125,194449-194506,194970-195128,195379-195401
          Length = 985

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 13/28 (46%), Positives = 14/28 (50%)
 Frame = +2

Query: 365  GMYRPVGWVLSWATHALRDLRQWPPPGL 448
            G   PVGW L + T  L D    PPP L
Sbjct: 926  GNNNPVGWPLRFLTPVLSDENSVPPPSL 953


>10_02_0175 - 6207485-6207898
          Length = 137

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 13/28 (46%), Positives = 13/28 (46%)
 Frame = -2

Query: 621 RWRPCVTRRAPWRTRWLQTARP*GNSSP 538
           RWR    RR  WR RW Q  R  G   P
Sbjct: 52  RWRAAAARRGEWR-RWRQRRRGGGRRRP 78


>09_01_0117 +
           1808669-1809181,1810038-1810059,1810170-1810223,
           1810684-1810892
          Length = 265

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 18/62 (29%), Positives = 27/62 (43%)
 Frame = -3

Query: 539 RRRDGAELSSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPADTFLP 360
           RRR  + L +    A   G P+          + AA++ G A     T+ P PP+ T  P
Sbjct: 98  RRRHSSHLFAAPRHASTAGAPIATLRYSAVLGIEAAVLVGTARD--STSSPIPPSSTGAP 155

Query: 359 AL 354
           +L
Sbjct: 156 SL 157


>04_04_1487 - 33919654-33920399,33920676-33920817
          Length = 295

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 26/70 (37%), Positives = 33/70 (47%), Gaps = 4/70 (5%)
 Frame = -3

Query: 623 RAGGRVSPDARRGGR---DGCRLRAPEATPRRRRDGAELSS-VQMQADLLGIPVIRPLMM 456
           R+GG V  D   G     +G       A PRRRR GA+++S V   AD   +P+  P   
Sbjct: 160 RSGGGVGGDEVDGAETFVEGGDKEGERAAPRRRRVGADVASRVCGGADEERVPL--PRRA 217

Query: 455 ESTALGAAIV 426
           E  A G  IV
Sbjct: 218 EVAAAGEIIV 227


>04_04_1220 + 31843628-31844755
          Length = 375

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = -2

Query: 441 GGGHCRRSRNACVAHDNTQPT 379
           GGGH R  R +CV  D+ +P+
Sbjct: 231 GGGHMRERRTSCVVVDDMEPS 251


>03_04_0069 - 17022468-17023361
          Length = 297

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 3/35 (8%)
 Frame = -3

Query: 629 QGRAGGRVSPDARRGGRDGCRLR---APEATPRRR 534
           +GRAG R +   R GGR   R+R   AP   PRRR
Sbjct: 254 RGRAGARGARVRRVGGRAARRVRHLGAPPCAPRRR 288


>08_01_0619 +
           5412058-5413224,5413357-5413476,5413755-5413831,
           5414201-5414321
          Length = 494

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 21/74 (28%), Positives = 36/74 (48%)
 Frame = +1

Query: 400 GHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPS 579
           GH  I RP+ ++   A   ++R R+TG  S+   + +++    + RRR          P+
Sbjct: 72  GHVTI-RPSELSRREA--QVLRARLTGELSRVRALLSDIDGWEARRRR----------PA 118

Query: 580 RPPRRASGDTRPPA 621
            PPR+    + PPA
Sbjct: 119 EPPRQRGHVSPPPA 132


>04_04_0726 + 27588225-27588685,27588768-27588895,27590523-27591016
          Length = 360

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 4/71 (5%)
 Frame = -3

Query: 581 RDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVI----RPLMMESTALGAAIVAGRA 414
           +  CR R      RRRR  A  +  +  A   G+PV+     P  + +++ GA  +   A
Sbjct: 165 KKSCRRRLAGHNERRRRSNASEAMARGSAHPHGMPVLGHGFPPYGLPTSSAGALSLLSSA 224

Query: 413 MRVWPTTIPSP 381
               P  +P+P
Sbjct: 225 RATGPWLMPTP 235


>03_05_0799 + 27809301-27811550
          Length = 749

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 16/57 (28%), Positives = 25/57 (43%)
 Frame = +1

Query: 451 LSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPA 621
           L +  G     P  SA    E+++A  L     +S +  + P  PP   SG+  PP+
Sbjct: 370 LYVSTGSAVPSPRASATATMEMAAAMGLMPGSPSSVSAVMSPFTPPMSPSGNGMPPS 426


>03_05_0355 - 23420410-23420548,23420643-23420794
          Length = 96

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = +1

Query: 415 ARPATMAAPRAVLSIMRGRMTGIPSKSACICTELS 519
           ARP   AA     + +  R+TG PS S   C ELS
Sbjct: 50  ARPMAAAAMMGSPAAVAARLTGHPSASVRACCELS 84


>02_01_0360 -
           2594534-2594601,2594778-2594829,2594915-2595029,
           2595124-2595212,2595326-2595391,2595468-2595657,
           2595811-2596037,2596111-2596185,2596283-2596354,
           2596507-2596577,2596848-2597036,2597186-2597298,
           2598063-2598268
          Length = 510

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 21/59 (35%), Positives = 27/59 (45%)
 Frame = +1

Query: 391 IVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARS 567
           + V    +A PA +AAP AVL+     +      SA      SS+P LRR     GA S
Sbjct: 17  LFVARVALAAPAQLAAPLAVLAAAALAVELAVDASASASASASSSP-LRRFRTRPGASS 74


>01_01_0937 -
           7388230-7388283,7388957-7389091,7389201-7389365,
           7389436-7389516,7389692-7389767,7389855-7389988,
           7390082-7390174,7390885-7391018,7391125-7391533,
           7392381-7392593
          Length = 497

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 22/74 (29%), Positives = 29/74 (39%)
 Frame = +1

Query: 367 NVSAGGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRG 546
           NV+AGG             A  AAP    S+  GR  G    SA        AP++ R  
Sbjct: 57  NVAAGGGAPGKAGNAKLNLAASAAPVKKGSLASGRNVGTNRASAVKSASAKPAPAISRHE 116

Query: 547 VASGARSLQPSRPP 588
            A+   S+ P + P
Sbjct: 117 SATQKESVLPPKVP 130


>10_08_0042 -
           14383143-14383628,14383647-14384609,14384697-14386443,
           14387901-14388010,14388767-14389003
          Length = 1180

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 2/44 (4%)
 Frame = +1

Query: 499 CICTEL--SSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPAR 624
           C C+ +   S PS R  GV+S    L PSRP +R  G  R   R
Sbjct: 140 CCCSGVLGGSPPSSRTAGVSSPG--LSPSRPSKRRIGRARVQPR 181


>05_07_0308 +
           29115892-29116083,29116771-29116885,29116978-29117087,
           29118225-29118350,29118450-29118570,29118665-29118749,
           29118854-29118967,29119061-29119100,29119517-29119665,
           29120223-29120412,29121674-29122228,29123588-29123815,
           29123904-29124044,29124134-29124334,29124447-29124728
          Length = 882

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 14/44 (31%), Positives = 20/44 (45%)
 Frame = +1

Query: 484 PSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRP 615
           PS      +  SS+ ++R R   S +RS  P  PP +    T P
Sbjct: 81  PSGPEVRSSSFSSSENVRARSSGSSSRSAAPPPPPPQTDSATNP 124


>05_04_0031 + 17353292-17354353
          Length = 353

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 15/28 (53%), Positives = 20/28 (71%), Gaps = 1/28 (3%)
 Frame = +1

Query: 484 PSKSACIC-TELSSAPSLRRRGVASGAR 564
           PS++A I  T  + AP+  RRGVASG+R
Sbjct: 187 PSEAAQISNTAATPAPAAARRGVASGSR 214


>04_04_0555 -
           26210346-26211458,26211530-26211719,26211826-26211960,
           26212072-26212169,26212262-26212425,26213558-26214032
          Length = 724

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +1

Query: 511 ELSSAPSLRRRGVASGARSLQPSRPPRRASGD 606
           E+  A  LRRRG  SG R+  PSR    A+ +
Sbjct: 22  EMVEASELRRRGKPSGDRATGPSRDGAAAAAE 53


>01_06_0049 - 25953811-25954131,25954223-25954903
          Length = 333

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 14/39 (35%), Positives = 20/39 (51%)
 Frame = +1

Query: 502 ICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPP 618
           I    +S   L ++  A+ A S  P+R PR +S  T PP
Sbjct: 187 ISVRSTSYLKLNQQSQAATATSAAPNRKPRTSSNPTNPP 225


>01_06_0040 -
           25874308-25874611,25875743-25875822,25876764-25876996,
           25877285-25877354
          Length = 228

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 23/71 (32%), Positives = 31/71 (43%)
 Frame = -3

Query: 569 RLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTI 390
           R R  E   + RR   +L   +M+ + L       L  E+  L   +   RAMRV P T+
Sbjct: 114 RPRQVEVWFQNRRARTKLKQTEMECEYLK-RCFGSLTEENRRLQREVEELRAMRVAPPTV 172

Query: 389 PSPPADTFLPA 357
            SP     LPA
Sbjct: 173 LSPHTRQPLPA 183


>09_04_0466 - 17838344-17838631
          Length = 95

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = -2

Query: 618 WRPCVTRRAPWRTRWLQTARP*GNSSPTEGWRRTQ 514
           WR  +T R  WR R   T     +SS   GWRRT+
Sbjct: 17  WRQALTWRGRWRMRPSTT-----SSSVGRGWRRTR 46


>08_01_0333 +
           2977397-2977648,2978416-2978784,2980108-2980169,
           2980271-2980418
          Length = 276

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = -3

Query: 515 SSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPADTFLPALT 351
           +++ M A L+G P   P M  +  +GAA+  G   ++W   + +PP      A T
Sbjct: 218 AAIMMNA-LVGGPSTGPSMNPARTIGAAVATGEYRQMW-IYLVAPPLGAIAGAAT 270


>07_03_0251 +
           15831712-15832127,15832203-15832344,15832692-15833056,
           15833134-15833293,15833699-15834036,15834138-15834315,
           15834454-15834987,15835176-15836291
          Length = 1082

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 9/23 (39%), Positives = 16/23 (69%)
 Frame = -3

Query: 290 WTDTKNEHVNAENQIELLQFCRR 222
           WT+ +   +N ++  ELL+FCR+
Sbjct: 780 WTEAEQGRLNYKDSDELLEFCRK 802


>03_03_0075 + 14280297-14280830
          Length = 177

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 1/67 (1%)
 Frame = +1

Query: 415 ARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRR-RGVASGARSLQPSRPPR 591
           A   T    R VL I R     +P + AC+   L++    R  R VA G  + +  R PR
Sbjct: 30  AASPTSGGKRIVLRI-RIPPAWMPEEDACLA-RLAAENGFRHWRRVAEGMAAARSGRRPR 87

Query: 592 RASGDTR 612
           R+ G  R
Sbjct: 88  RSPGQCR 94


>02_02_0256 - 8362374-8363003
          Length = 209

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 2/87 (2%)
 Frame = +1

Query: 355 RAGRNVSAGGLGIVVGHTRIARPATMAAPRAVLSIMRGRM-TGIPSKSACICTELSSAPS 531
           R GR+ +AGG G +V   +    A  AAP AV+ ++   +   +P           SAP 
Sbjct: 45  RRGRSPAAGGGGGMVRDDQEPTVARPAAPSAVVVVVAPPLPPPLPIHRVPAAAVQPSAPP 104

Query: 532 LRRRGVASGARSLQPSRPPRRAS-GDT 609
           +    VA  A + +  +  RR S GD+
Sbjct: 105 VVADDVALLAYAYEKKKKKRRGSDGDS 131


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,081,723
Number of Sequences: 37544
Number of extensions: 429310
Number of successful extensions: 1682
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 1591
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1680
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1537558360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -