SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30059.Seq
         (702 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_1068 - 8413269-8413589,8414011-8414262,8417472-8417603,841...    31   0.67 
07_01_0484 - 3643294-3643478,3644282-3644555,3644646-3645018,364...    29   2.7  

>01_01_1068 -
           8413269-8413589,8414011-8414262,8417472-8417603,
           8417684-8417812
          Length = 277

 Score = 31.5 bits (68), Expect = 0.67
 Identities = 14/57 (24%), Positives = 33/57 (57%)
 Frame = +2

Query: 530 LLSYAPIYIPYKELGV*D*SSGQRDVLTQLIPDRQKKVSIPLGNHCIWSLPVGKVKC 700
           +L+ +P+++ ++ L +        ++LT ++ D    +SIPL + C  +  +GK++C
Sbjct: 108 VLALSPVWVSWRSLQMRKLWLWGANILTVVLRDALNMISIPLASCCQRNKDMGKIEC 164


>07_01_0484 -
           3643294-3643478,3644282-3644555,3644646-3645018,
           3645177-3645233,3646034-3646458
          Length = 437

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 16/41 (39%), Positives = 20/41 (48%)
 Frame = +2

Query: 386 DITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHFTT 508
           D   I C  G  V++I  S  H +    +  DS IGYHF T
Sbjct: 181 DCLKINCTVGVVVSTIDYSRPHSI----LVPDSDIGYHFGT 217


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,761,554
Number of Sequences: 37544
Number of extensions: 347239
Number of successful extensions: 705
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 691
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 705
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1803843684
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -