SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30044.Seq
         (443 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_03_0661 - 16726958-16726966,16727133-16727234                       51   4e-07
01_02_0115 - 11248021-11248101,11249017-11249118                       51   4e-07
02_04_0206 + 20916063-20919669,20919816-20920014,20920935-209210...    28   2.9  
06_03_0336 + 19671500-19672150,19672681-19673301                       27   5.1  
03_06_0273 + 32787021-32787434,32788096-32788221,32788305-327883...    27   6.8  
03_02_0952 + 12666750-12666777,12666965-12667185,12669464-126696...    27   9.0  

>05_03_0661 - 16726958-16726966,16727133-16727234
          Length = 36

 Score = 51.2 bits (117), Expect = 4e-07
 Identities = 21/28 (75%), Positives = 25/28 (89%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTR 248
           MAKSKNHT HNQ+ KAH+NGIKKP++ R
Sbjct: 1   MAKSKNHTAHNQSYKAHKNGIKKPKRHR 28


>01_02_0115 - 11248021-11248101,11249017-11249118
          Length = 60

 Score = 51.2 bits (117), Expect = 4e-07
 Identities = 21/28 (75%), Positives = 25/28 (89%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTR 248
           MAKSKNHT HNQ+ KAH+NGIKKP++ R
Sbjct: 1   MAKSKNHTAHNQSYKAHKNGIKKPKRHR 28



 Score = 37.5 bits (83), Expect = 0.005
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = +2

Query: 236 KEDQARTTLGMDPKFLRNQRFCKKGNLK 319
           K  +  +T GMDPKFLRNQR+ +K N K
Sbjct: 25  KRHRQTSTKGMDPKFLRNQRYSRKHNKK 52


>02_04_0206 + 20916063-20919669,20919816-20920014,20920935-20921074,
            20921184-20921263,20922759-20922875,20923089-20923136,
            20923509-20923601,20923881-20923958,20924114-20924218,
            20924543-20925212,20925253-20925350,20925887-20925963,
            20926035-20926117,20926208-20926287,20927060-20927139,
            20927698-20927743,20928709-20929181,20929234-20929579
          Length = 2139

 Score = 28.3 bits (60), Expect = 2.9
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 6/28 (21%)
 Frame = -1

Query: 308  PSCKT------FDSLKILDPCQGWFVPG 243
            P+C+T      F+S+K+L PC+ W V G
Sbjct: 1448 PNCRTEKLYSYFESIKLLFPCEQWMVNG 1475


>06_03_0336 + 19671500-19672150,19672681-19673301
          Length = 423

 Score = 27.5 bits (58), Expect = 5.1
 Identities = 13/28 (46%), Positives = 15/28 (53%)
 Frame = +1

Query: 262 WHGSKIFKESKVLQEG*PEASQATREGG 345
           WH    FK S+    G PEA+ A  EGG
Sbjct: 223 WHEINQFKSSEKSLVGMPEAAAAEEEGG 250


>03_06_0273 +
           32787021-32787434,32788096-32788221,32788305-32788378,
           32788468-32788537,32788622-32788677,32788762-32788833,
           32788945-32789039,32789196-32789262,32789359-32789488,
           32789578-32789793,32789887-32790017,32790719-32790893,
           32790977-32791067,32792151-32792308,32792763-32792951,
           32793066-32793125
          Length = 707

 Score = 27.1 bits (57), Expect = 6.8
 Identities = 20/79 (25%), Positives = 33/79 (41%), Gaps = 3/79 (3%)
 Frame = +1

Query: 106 CVGIYSNDFIFLYRIENSSKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNHPWHGSKIFK 285
           C  +Y    +FL++     +W+    I  I      + +V  S+G P T   +  S+ F 
Sbjct: 529 CSQVYELSQVFLHKDWIMEQWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFP 588

Query: 286 E---SKVLQEG*PEASQAT 333
               +K  +EG    S AT
Sbjct: 589 YKWINKKWKEGFHVTSMAT 607


>03_02_0952 +
           12666750-12666777,12666965-12667185,12669464-12669649,
           12670147-12670212,12670335-12670427,12670528-12670659,
           12670794-12670895,12670993-12671070,12671148-12671219,
           12672185-12672292,12672368-12672465,12672904-12672964,
           12673058-12673120,12673228-12673284,12673571-12673729,
           12674310-12674441,12674516-12674602,12674667-12674738,
           12675899-12675985,12676052-12676427,12676727-12676788,
           12676946-12677014,12677096-12677142,12677189-12677342,
           12677874-12677999
          Length = 911

 Score = 26.6 bits (56), Expect = 9.0
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +1

Query: 115 IYSNDFIFLYRIENSSKWQSQRIIQIITKTAKLTEMVSKSQG 240
           +   D +   RIEN      +RI++  TK +KL ++  K++G
Sbjct: 214 VEDTDMVTFERIENEFGVTVRRIVEGETKVSKLGKLQCKNEG 255


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,261,624
Number of Sequences: 37544
Number of extensions: 157966
Number of successful extensions: 405
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 399
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 405
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 847740284
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -