SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30018.Seq
         (825 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1163 - 24439976-24440023,24440562-24440597,24440932-244410...    31   1.1  
10_08_0810 + 20734490-20734606,20735182-20735433,20735521-207356...    30   2.6  
08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366...    30   2.6  
01_01_1069 - 8420454-8420670,8421272-8421447,8421556-8421738,842...    30   2.6  
05_06_0102 - 25589011-25589181,25589269-25589496,25589589-255899...    29   4.5  
03_02_0400 - 8135283-8135490,8136047-8136213,8136289-8136477,813...    28   7.8  

>07_03_1163 -
           24439976-24440023,24440562-24440597,24440932-24441018,
           24441349-24441492,24441782-24441916,24442215-24442279,
           24442395-24442477,24442607-24442642,24443343-24443449,
           24443558-24443658,24443750-24443909
          Length = 333

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 12/37 (32%), Positives = 24/37 (64%)
 Frame = +1

Query: 307 VTALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQTYNI 417
           V+A+ W  +  +YS + D  V +W+++ G  K+T+N+
Sbjct: 243 VSAVTWPERQTIYSASWDHSVRQWDVQTG--KETWNM 277


>10_08_0810 +
           20734490-20734606,20735182-20735433,20735521-20735664,
           20735774-20736493,20736955-20737177,20737463-20737523,
           20738294-20738615
          Length = 612

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 3/60 (5%)
 Frame = +1

Query: 313 ALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQTY---NISIENNTKQGSHINAIKIIPHNP 483
           A++    Y  YSC +D  V  +++   +  + +   N   ++      H+NAI I P NP
Sbjct: 151 AIEPGSPYIFYSCGEDGLVQHFDLRTNTATKLFQCRNSLSKSGHSSNIHLNAITIDPRNP 210


>08_01_0410 +
           3661304-3661383,3661494-3661673,3661757-3661870,
           3661975-3662133,3662193-3662243,3662838-3663018,
           3663102-3663228,3663322-3663431,3663529-3663667,
           3663767-3663876,3664002-3664071,3664247-3664320,
           3664458-3664553,3664682-3664777,3665041-3665168,
           3665422-3665656,3665743-3665910,3666274-3666381,
           3666468-3666617,3666905-3667015,3667118-3667297,
           3667427-3667555,3667819-3667914,3668108-3668293,
           3668431-3668603,3668720-3668921
          Length = 1150

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = +1

Query: 358 DSRVYEWNIEDGSVKQTYN 414
           DS + EWN  +G++K+TYN
Sbjct: 583 DSHLVEWNETEGAIKRTYN 601


>01_01_1069 -
           8420454-8420670,8421272-8421447,8421556-8421738,
           8421885-8421980,8422064-8422192,8422266-8422445,
           8422524-8422634,8422714-8422869,8422983-8423078,
           8423160-8423327,8423402-8423642,8423724-8423851,
           8424042-8424134,8424214-8424309,8424431-8424523,
           8424741-8424850,8424999-8425134,8425215-8425315,
           8426029-8426152,8426237-8426411,8426523-8426681,
           8427423-8427536,8427669-8427848,8428926-8429005
          Length = 1113

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +1

Query: 283 PAKHFSAKVTALDWSRKYGLYSC--TKDSRVY--EWNIEDGSVKQTYN 414
           P K  +  + + D +R   L+SC  +KD   Y  EWN  +GS+K+TY+
Sbjct: 515 PGKWCTTMLYSADGTR---LFSCGTSKDGDSYLVEWNESEGSIKRTYS 559


>05_06_0102 -
           25589011-25589181,25589269-25589496,25589589-25589933,
           25590406-25590777,25590957-25591049,25591150-25591401,
           25592019-25593224
          Length = 888

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +1

Query: 328 RKYGLYSCTKDSRVYEWNIEDGS 396
           R  G Y+ TKD  ++ WN+ +GS
Sbjct: 202 RVTGAYTITKDGAIFTWNLVEGS 224


>03_02_0400 -
           8135283-8135490,8136047-8136213,8136289-8136477,
           8136560-8136655,8136746-8136874,8136947-8137123,
           8137256-8137366,8138592-8138792,8139022-8139186,
           8139293-8139527,8139618-8139745,8139833-8139928,
           8140017-8140112,8140252-8140325,8140393-8140462,
           8140556-8140665,8140753-8140906,8141040-8141155,
           8141259-8141379,8141464-8141641,8142331-8142489,
           8142619-8142732,8142821-8143000,8143098-8143177
          Length = 1117

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 4/28 (14%)
 Frame = +1

Query: 340 LYSC--TKD--SRVYEWNIEDGSVKQTY 411
           L+SC  +KD  S + EWN  +G+VK+TY
Sbjct: 560 LFSCGTSKDGESHLVEWNESEGAVKRTY 587


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,302,039
Number of Sequences: 37544
Number of extensions: 367439
Number of successful extensions: 754
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 754
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2268190812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -