SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30011.Seq
         (628 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_01_0740 + 6243517-6243526,6244822-6245323,6245415-6245496,624...   132   2e-31
03_02_0897 - 12239375-12239458,12240035-12240116,12240213-122407...   130   7e-31
05_01_0490 + 4083768-4083775,4083845-4084336,4084441-4084522,408...   116   1e-26
10_08_0141 + 15159160-15159306,15159708-15159815,15159958-151600...    29   2.3  

>11_01_0740 +
           6243517-6243526,6244822-6245323,6245415-6245496,
           6245741-6245821
          Length = 224

 Score =  132 bits (319), Expect = 2e-31
 Identities = 59/85 (69%), Positives = 65/85 (76%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYR  KNKPYPKSR  RGVPDPKIRI+D+G     VD+FP CVHLVS E E +SSE
Sbjct: 4   RPARCYRQIKNKPYPKSRYCRGVPDPKIRIYDVGMKKKGVDEFPYCVHLVSWEKENVSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RI CN Y+ KN G D FH+R
Sbjct: 64  ALEAARIACNKYMTKNAGKDAFHLR 88



 Score =  115 bits (277), Expect = 3e-26
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R+HPFHV+RINKMLSCAGAD LQTGMR AFGKPQGT ARV IGQ ++SVR   +     
Sbjct: 89  VRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKPQGTCARVDIGQVLLSVRC--KESNAK 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
           H   A     FKFPGR K +  ++ GFTK+ R+E+ KL
Sbjct: 147 HAEEALRRAKFKFPGRQKIIHSRKWGFTKFTREEYVKL 184


>03_02_0897 -
           12239375-12239458,12240035-12240116,12240213-12240714,
           12241150-12241303,12241458-12241629,12242237-12242443,
           12242926-12243323
          Length = 532

 Score =  130 bits (315), Expect = 7e-31
 Identities = 58/84 (69%), Positives = 64/84 (76%)
 Frame = +1

Query: 4   PARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSEA 183
           P RCYR  KNKPYPKSR  RGVPDPKIRIFD+G+     DDFPLCVHLVS E E +SSEA
Sbjct: 312 PVRCYRQIKNKPYPKSRYCRGVPDPKIRIFDVGQKKRSADDFPLCVHLVSWEKENVSSEA 371

Query: 184 LEAGRICCNXYLVKNCGXDQFHIR 255
           LEA RI CN Y+ K+ G D FH+R
Sbjct: 372 LEAARIACNKYMAKHAGKDAFHLR 395



 Score =  109 bits (262), Expect = 2e-24
 Identities = 55/95 (57%), Positives = 67/95 (70%), Gaps = 1/95 (1%)
 Frame = +3

Query: 264 HPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRG 443
           HP+HV+RINKMLSCAGAD LQTGMR AFGKP GT ARVRIGQ ++SVR   +     H  
Sbjct: 399 HPYHVLRINKMLSCAGADRLQTGMRGAFGKPTGTCARVRIGQVLLSVRC--RDANAAHAQ 456

Query: 444 SA-PSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
            A     FKFPGR + +   + GFT+++RDE+ KL
Sbjct: 457 EALRRAKFKFPGRQRVIFSAKWGFTRFKRDEYLKL 491


>05_01_0490 +
           4083768-4083775,4083845-4084336,4084441-4084522,
           4086671-4087357,4087555-4087813,4088435-4088558,
           4089474-4089564
          Length = 580

 Score =  116 bits (280), Expect = 1e-26
 Identities = 52/81 (64%), Positives = 60/81 (74%)
 Frame = +1

Query: 13  CYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSEALEA 192
           CYR  KNKPYPKSR  RGVPDPKIRI+D+G     VD+F  CVHLVS E E ++SEALEA
Sbjct: 4   CYRQIKNKPYPKSRYCRGVPDPKIRIYDVGMKKKGVDEFSHCVHLVSWEKENVTSEALEA 63

Query: 193 GRICCNXYLVKNCGXDQFHIR 255
            RI CN Y+ K+ G D FH+R
Sbjct: 64  ARIACNKYMTKSAGKDAFHLR 84



 Score =  116 bits (280), Expect = 1e-26
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R+HPFHV+RINKMLSCAGAD LQTGMR AFGKPQGT ARV IGQ ++SVR   +     
Sbjct: 85  VRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKPQGTCARVDIGQVLLSVRC--KPNNAV 142

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
           H   A     FKFPGR K +  ++ GFTK+ RDE+ +L
Sbjct: 143 HASEALRRAKFKFPGRQKIIESRKWGFTKFSRDEYVRL 180


>10_08_0141 +
           15159160-15159306,15159708-15159815,15159958-15160006,
           15160067-15160182,15160358-15160399,15161026-15161442,
           15162356-15162509,15162911-15162975,15163793-15163870,
           15163951-15164061,15164227-15164271,15164677-15164850,
           15165383-15166335,15166471-15166681,15167037-15167196,
           15168786-15169174
          Length = 1072

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%)
 Frame = +1

Query: 130 PLC-VHLVSDEYEQLSSEALEAGRICCNXYLVKNCG 234
           P C +HL SD Y   S E ++AG+  C   L K  G
Sbjct: 592 PRCDIHLKSDGYTNYSLETVQAGKQQCKAALQKELG 627


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,100,508
Number of Sequences: 37544
Number of extensions: 313463
Number of successful extensions: 623
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 607
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 620
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1525730988
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -