BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30128 (628 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0138 + 13325418-13325954 29 3.0 07_03_1037 - 23438205-23441219,23443509-23444513,23444627-23446708 29 3.0 06_01_0936 - 7220333-7220508,7221208-7221327,7221898-7223089 29 4.0 12_02_0403 - 18627246-18627557,18627904-18628836 27 9.2 10_08_0418 - 17779499-17780952,17781177-17782017 27 9.2 05_04_0280 - 19752112-19752451,19754104-19755587 27 9.2 >10_07_0138 + 13325418-13325954 Length = 178 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -3 Query: 584 RRCSYRFSASKRWQPRDTRSARWQHL*PYRRSW 486 RRCS R+ S+RW+ R +R RW RRSW Sbjct: 85 RRCSRRWRRSRRWRSRCSR--RW------RRSW 109 >07_03_1037 - 23438205-23441219,23443509-23444513,23444627-23446708 Length = 2033 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -1 Query: 337 CRSMHLMTWRPASAKQTRSLDQSMATELE 251 CR +H + WR +SA++ L++ M +E Sbjct: 1659 CRDVHHLPWRSSSARRELELEEGMDCSIE 1687 >06_01_0936 - 7220333-7220508,7221208-7221327,7221898-7223089 Length = 495 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 336 HSRQIETIAENCRYPFGLAINGDKLY 413 H + I T++ N Y GLA++GD LY Sbjct: 23 HYQCIATLSGNSSYVSGLAVDGDSLY 48 >12_02_0403 - 18627246-18627557,18627904-18628836 Length = 414 Score = 27.5 bits (58), Expect = 9.2 Identities = 25/82 (30%), Positives = 34/82 (41%), Gaps = 2/82 (2%) Frame = +3 Query: 198 EHGRHGKISP-PR*PRCEASNSVAIDWSRDRVC-FADAGLQVIKCIDLHSRQIETIAENC 371 EH R ++P P RC S+A D C D G ++ I +H R C Sbjct: 258 EHERVAAVAPLPAMSRCRLPVSMA---KEDACCQLTDVGGRLGVSIAIHQRN-----SIC 309 Query: 372 RYPFGLAINGDKLYWSDWRTLK 437 + L G K WS WRT++ Sbjct: 310 IEVWLLEGRGGKQKWSKWRTIQ 331 >10_08_0418 - 17779499-17780952,17781177-17782017 Length = 764 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -3 Query: 317 DLEARVREANSISRPVDGHRVGSFTSGLPRRTDLSVPSMFAH 192 + E R E ++ V GH V PR D+ VP+ +A+ Sbjct: 516 NFETRAYELRCRTQLVGGHEVWKPAESPPRAADMEVPAAYAN 557 >05_04_0280 - 19752112-19752451,19754104-19755587 Length = 607 Score = 27.5 bits (58), Expect = 9.2 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Frame = -2 Query: 285 DLSTSRWPQSWKLHIWATEED*SFRAVHVR----PLDLRIASIP-VSPEDFPSL 139 D + +RWP SW A SF A H+R P+ I ++P V P+ P+L Sbjct: 44 DPAAARWPSSWSP---AAPPLHSFAASHLREAVSPIAAAILALPGVDPDPLPAL 94 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,386,590 Number of Sequences: 37544 Number of extensions: 407664 Number of successful extensions: 1276 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1276 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -