SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_1036 + 8134132-8134539,8134885-8134956,8134969-8135088,813...    32   0.35 
03_02_1023 + 13265179-13265330,13265526-13265637,13265752-132660...    32   0.35 
10_08_0043 - 14390398-14391531,14391850-14393691,14393800-143968...    30   1.9  
03_05_0211 - 22020515-22020687,22020801-22020831,22022060-220221...    29   3.3  
09_06_0082 + 20749425-20749589,20750137-20750238,20750320-207503...    29   4.3  
07_03_0018 - 12490940-12491195,12491575-12491775,12492174-124924...    29   4.3  
04_03_0498 + 16574250-16574312,16576576-16577457,16578624-165787...    29   4.3  
03_06_0449 - 34013973-34014056,34014595-34014630,34014729-340148...    29   4.3  
02_03_0287 + 17320242-17320481,17323422-17324767,17325124-17325142     28   7.5  

>06_01_1036 + 8134132-8134539,8134885-8134956,8134969-8135088,
            8135179-8135256,8135442-8135697,8136427-8136515,
            8137229-8137376,8137460-8137899,8138048-8138562,
            8138791-8139061,8139231-8139492,8139583-8139938
          Length = 1004

 Score = 32.3 bits (70), Expect = 0.35
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +1

Query: 511  PTKRKRIRLNPVDSDDSDVENKADNKIGTT 600
            P  R+R R +P  SDDSD++ + DN   T+
Sbjct: 915  PPSRRRARRSPSSSDDSDIDGQEDNLHATS 944


>03_02_1023 + 13265179-13265330,13265526-13265637,13265752-13266048,
            13266361-13266623,13267637-13267847,13268420-13268590,
            13268671-13268748,13269275-13269520,13269763-13271868,
            13272122-13273904,13274113-13274216,13274752-13275108,
            13275210-13275328,13276175-13276436,13276669-13276893,
            13277075-13277214,13278087-13278159,13278431-13278532,
            13278647-13279018,13279183-13279230,13279516-13279900,
            13280440-13280558
          Length = 2574

 Score = 32.3 bits (70), Expect = 0.35
 Identities = 17/43 (39%), Positives = 21/43 (48%)
 Frame = +1

Query: 367  LLKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEE 495
            LLK+ I   P  S  K   +ENK    + T SP   K SS E+
Sbjct: 1589 LLKVSIKKTPEPSISKDAQVENKSLHMKATDSPGKNKTSSTEK 1631


>10_08_0043 -
           14390398-14391531,14391850-14393691,14393800-14396825,
           14397510-14397609
          Length = 2033

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 12/44 (27%), Positives = 26/44 (59%)
 Frame = +1

Query: 442 ERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVEN 573
           E  +     L   S +E   ++L TK+ +++L+ V++ ++D+EN
Sbjct: 757 EAALLAMTNLNSESQEEVNRLTLETKKLKVKLSEVENSNTDLEN 800


>03_05_0211 -
           22020515-22020687,22020801-22020831,22022060-22022169,
           22022715-22023102,22023344-22023397,22023739-22023849,
           22023956-22024015,22024618-22024694,22026155-22026188,
           22026267-22027235
          Length = 668

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = +1

Query: 385 VMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSD 564
           +  P+ + +KG +  ++KR+R  TP    KK   D++  I+   KR +      D D+ D
Sbjct: 408 IPTPKANIRKGSN--SRKRKRGSTPKSSSKKFDDDDD--ITPSKKRNKALEYDTDEDEDD 463

Query: 565 VE-NKADNK 588
            +  K+D++
Sbjct: 464 ADPMKSDSE 472


>09_06_0082 +
           20749425-20749589,20750137-20750238,20750320-20750384,
           20750471-20750588,20750937-20751012,20751304-20751365,
           20751457-20751588,20751686-20751739,20751969-20752034,
           20752115-20752189,20752271-20752321
          Length = 321

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 16/58 (27%), Positives = 32/58 (55%)
 Frame = +1

Query: 409 KKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKAD 582
           +K +++  K  E +     +L+K   +EEE+     K++R+R +P  S   ++EN +D
Sbjct: 88  EKRVNIRTKIEEEE---KEKLQKLQQEEEELQMQKRKKRRVRGDPRLSFCDEIENGSD 142


>07_03_0018 -
           12490940-12491195,12491575-12491775,12492174-12492403,
           12492624-12492744,12492823-12492972,12493106-12493314,
           12494120-12494234,12494346-12494440,12494523-12494758,
           12496182-12496338
          Length = 589

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 2/33 (6%)
 Frame = +2

Query: 236 YNKRRYDSYSNYNNVETK--QHRGSQYSFQLFY 328
           Y+  +YDS  ++ +++ K  QH GS+ S +LFY
Sbjct: 179 YHSGQYDSEEHFMDLDKKLKQHEGSRVSNRLFY 211


>04_03_0498 +
           16574250-16574312,16576576-16577457,16578624-16578714,
           16578802-16578857,16579527-16579640
          Length = 401

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +3

Query: 330 KTPPTNKKLKADATEDTDCNGSPKKQ*KRNTS*KQKTRKANYTLT 464
           +T P   K    + +   C G+P+   KR  + K+  R+A+Y  T
Sbjct: 261 ETVPNEDKTPCTSLDVRGCEGTPRASLKRRVNKKRTKREASYPTT 305


>03_06_0449 -
           34013973-34014056,34014595-34014630,34014729-34014816,
           34015034-34015143,34015611-34015715,34015812-34015903,
           34016145-34016232,34016407-34016526,34016603-34016721,
           34017253-34018126
          Length = 571

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 472 KKASSDEEEVISLPTKRKRIRLNPVDSDDSDVEN 573
           K   SD EE +  P KRKR++L+P D+ +  +E+
Sbjct: 253 KDPVSDIEETLP-PKKRKRMKLDPYDTSNKRLED 285


>02_03_0287 + 17320242-17320481,17323422-17324767,17325124-17325142
          Length = 534

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = +3

Query: 273 TMSKRNSTGAANTLFNYFTKTPPTNKKLKADATEDTDCN 389
           T ++  + G  N +F ++T TPP        + +DT C+
Sbjct: 134 TTARGLTRGGKNIVFTFWTATPPRASFFTLHSPDDTKCS 172


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,774,979
Number of Sequences: 37544
Number of extensions: 221784
Number of successful extensions: 639
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 621
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 639
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1644004708
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -