SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B17
         (629 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0328 + 2553850-2553902,2553990-2554050,2554163-2554321          119   2e-27
02_01_0082 - 564946-565075,565164-565384,565662-565916                 29   4.0  
12_01_0515 + 4081373-4081622,4081725-4081867,4082061-4082219,408...    28   5.3  
09_06_0257 + 21891523-21891578,21891911-21892421,21893021-218930...    28   5.3  
11_04_0096 + 13435988-13436803,13436880-13437053,13437673-134378...    27   9.3  
07_03_0932 + 22726529-22727338,22729097-22729462,22729841-22730026     27   9.3  

>03_01_0328 + 2553850-2553902,2553990-2554050,2554163-2554321
          Length = 90

 Score =  119 bits (286), Expect = 2e-27
 Identities = 44/68 (64%), Positives = 60/68 (88%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QIQYSE+Y DD YEYRHV+LPP++A+++PK+ L++E EWR +GVQQS GW+H+ +H PEP
Sbjct: 3   QIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEP 62

Query: 302 HVLLFRRP 325
           H++LFRRP
Sbjct: 63  HIMLFRRP 70


>02_01_0082 - 564946-565075,565164-565384,565662-565916
          Length = 201

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
 Frame = +2

Query: 407 RHIFRCH----SLILFKLLIETIIVKTKKKNCSIYYKLADINYYY 529
           +H +RCH       L    +E + ++ K+K   ++YKLA +N+ Y
Sbjct: 85  KHSWRCHVEPPPNALETAEVEALKLEVKQKKEELFYKLATLNWQY 129


>12_01_0515 +
           4081373-4081622,4081725-4081867,4082061-4082219,
           4082339-4082518,4082616-4082845,4082959-4083099,
           4083366-4083420
          Length = 385

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 5/58 (8%)
 Frame = +2

Query: 107 VMPVDQIQYSERYTDDVYEY--RHVILPPDIARMVP---KSHLMTETEWRNLGVQQSP 265
           + P D    S +Y   + E+  R+   PP +A  +    K+  +  +EW+N GVQ  P
Sbjct: 95  LFPCDVTDESPQYHAYLQEFYRRNCSAPPSVAAAISLCLKNERILRSEWQNRGVQVHP 152


>09_06_0257 +
           21891523-21891578,21891911-21892421,21893021-21893092,
           21893571-21893875,21894085-21894196,21894514-21894750,
           21894933-21895640
          Length = 666

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +3

Query: 234 SGETLVFSRVPAGSTLWCTILNPMFYYL 317
           S   L+++RV  GS L+   ++P FYYL
Sbjct: 73  SSMVLMWNRVFLGSCLFALFIDPFFYYL 100


>11_04_0096 +
           13435988-13436803,13436880-13437053,13437673-13437834,
           13438548-13438690,13439059-13439134,13439231-13439403,
           13439482-13439563,13439949-13440026,13440369-13440461,
           13441026-13441187,13441225-13441530,13442265-13442369,
           13443097-13443243
          Length = 838

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 12/30 (40%), Positives = 14/30 (46%)
 Frame = +2

Query: 215 HLMTETEWRNLGVQQSPGWLHFMVHNPEPH 304
           H MT  +WRN+G Q  P    F      PH
Sbjct: 736 HGMTIAQWRNMGYQNQPEHQQFAQLLQAPH 765


>07_03_0932 + 22726529-22727338,22729097-22729462,22729841-22730026
          Length = 453

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = +2

Query: 83  LFDAIKTTVMPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHL 220
           LFDA+ +  +PV    Y E   +DV +YR++ +  + ++ V    L
Sbjct: 326 LFDALVSLCVPVIVSDYIELPFEDVIDYRNISIFVETSKAVQPGFL 371


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,939,519
Number of Sequences: 37544
Number of extensions: 306282
Number of successful extensions: 651
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 638
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 651
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1537558360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -