SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B16
         (656 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_05_0034 + 8431753-8431790,8431940-8432063,8432726-8433038,843...    32   0.35 
02_04_0482 + 23291986-23292181,23292289-23292317,23293500-232936...    29   3.3  
08_02_1499 - 27558872-27559015,27559544-27559666,27560214-275603...    29   4.3  
07_03_1345 + 25919379-25920866,25921342-25921962,25922733-259228...    29   4.3  
01_03_0225 + 13960843-13962417                                         29   4.3  
08_02_1091 + 24256025-24256190,24256806-24257978,24258066-242587...    28   7.5  
04_04_0253 - 23944279-23944358,23944634-23944711,23945118-239452...    28   7.5  
10_08_0858 - 21108283-21108387,21108820-21108889,21109490-211096...    27   9.9  
07_03_0140 + 14238645-14238849,14239081-14239163                       27   9.9  

>10_05_0034 +
           8431753-8431790,8431940-8432063,8432726-8433038,
           8433189-8433251,8433778-8434058
          Length = 272

 Score = 32.3 bits (70), Expect = 0.35
 Identities = 26/94 (27%), Positives = 41/94 (43%)
 Frame = +3

Query: 18  NAPPTLPVSLLVSCETNFKIKTFTTMLREKSSCENRHSTEQDRRQLPSNRLPPIEELTLG 197
           ++P TL + +L    T+  I      L+ KS    + ST QD +  PSN  P    +   
Sbjct: 119 SSPSTLDLLILDKHGTSLAIPPSKRDLKLKS----KRSTHQDSKGHPSNTDPGPSRIINR 174

Query: 198 LKQKLHLQARARAAPYYIRKQEPVDLVERLLEQR 299
              K    A  +    Y  K+ P+D +E+L+  R
Sbjct: 175 RVTKSESSANTQLLVQYFSKRYPIDHLEQLMTGR 208


>02_04_0482 +
           23291986-23292181,23292289-23292317,23293500-23293602,
           23293855-23293979,23294788-23294920,23295468-23295739,
           23295806-23295873,23296126-23296265,23296443-23296529,
           23296610-23297118,23297203-23298020,23298054-23298252,
           23299084-23299228,23299260-23299314,23301184-23301310,
           23301399-23301468,23301980-23302085,23302168-23302279,
           23302775-23302897,23303000-23303159,23303283-23303359,
           23303457-23303509,23303683-23303737,23304032-23304706
          Length = 1478

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = +1

Query: 385 KHSICESVEHVVKSLVCMKRVGLQWCYMRRACEKRMAICD 504
           +H+ C        S + +  V L+W +  RAC  R  ICD
Sbjct: 91  RHAFCHGPAFPTLSKILLGHVALKWLHQIRAC-ARKEICD 129


>08_02_1499 -
           27558872-27559015,27559544-27559666,27560214-27560312,
           27561257-27561307
          Length = 138

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 10/45 (22%), Positives = 27/45 (60%)
 Frame = +3

Query: 183 ELTLGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQRALVAEA 317
           E+ +GL+++ H+     +A      ++   L+++L+EQ++  A++
Sbjct: 93  EIVMGLEEEFHISVEESSAQSIATVEDAAALIDKLVEQKSAEAKS 137


>07_03_1345 +
           25919379-25920866,25921342-25921962,25922733-25922893,
           25923284-25923422,25923509-25923592,25923944-25923982,
           25924037-25924222,25924347-25924478,25924810-25925009,
           25925294-25925498,25925618-25925944
          Length = 1193

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 19/81 (23%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
 Frame = +3

Query: 135 EQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDLVE---RLLEQRAL 305
           +++ + +PS    P + +    ++  H+ +   A  +  ++ + + L+E   R + +++ 
Sbjct: 674 KENAKYIPSTSKGPCKSMH---EKSAHIASECSAFYFVSQQSQSISLLEETDRQIREKSC 730

Query: 306 VAEAVRRLKEKKQPCHEISVD 368
           + E VRRLKE +   HE  VD
Sbjct: 731 M-EQVRRLKEARNSYHEELVD 750


>01_03_0225 + 13960843-13962417
          Length = 524

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 15/32 (46%), Positives = 17/32 (53%)
 Frame = -3

Query: 552 RAAILVRSRDSCRARHVTDSHPFLARSPHIAP 457
           RAAI V SR+      V   H F +R P IAP
Sbjct: 83  RAAIFVSSREVTHRALVQRGHTFASRPPAIAP 114


>08_02_1091 + 24256025-24256190,24256806-24257978,24258066-24258733,
            24258994-24260065,24260241-24260563,24260647-24260835,
            24261400-24261506,24262103-24262163,24262617-24262634
          Length = 1258

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 4/86 (4%)
 Frame = +3

Query: 99   REKSSCENRHSTEQDRRQLPS-NRLPPIE-ELTLGLKQKLHLQARARAAPYYIRKQEPVD 272
            +E    ++ H  E   R L + N +   E  L  G K    + +     P   +KQ P  
Sbjct: 965  KEVKVTQSLHDRESKGRILGNQNEIHKSEVNLDKGWKPSNIVTSMTSFIPLVKQKQRPTT 1024

Query: 273  L-VERLLEQRAL-VAEAVRRLKEKKQ 344
            + V+R +  +AL VAEAV+R ++KKQ
Sbjct: 1025 VCVKRDVRVKALEVAEAVKRREQKKQ 1050


>04_04_0253 -
           23944279-23944358,23944634-23944711,23945118-23945235,
           23945496-23945594,23946615-23947418
          Length = 392

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = -2

Query: 169 NLLEGNCLLSCSVLWRFSQLDFSLSIVVKVL-ILKFVSHETRRLTGNVGGALRLR 8
           + L+G+C LSC  L R  +L  ++ + +++  +L  +S+ +  L G    A + R
Sbjct: 277 HFLDGDCYLSCEKLQRQLKLQLAVQLKIELKNMLPRISYSSYALFGGCSEATKSR 331


>10_08_0858 -
           21108283-21108387,21108820-21108889,21109490-21109646,
           21109930-21110062,21110409-21110583,21113353-21113453,
           21113620-21113706,21115871-21115931,21116114-21116178,
           21116534-21117631
          Length = 683

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = +3

Query: 402 KCGTCCEIACVYETCRITMVLYAESVREKD 491
           K G+    AC    C + MVLY   ++E++
Sbjct: 366 KLGSASASACADAECHVAMVLYCPLIKERE 395


>07_03_0140 + 14238645-14238849,14239081-14239163
          Length = 95

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 15/56 (26%), Positives = 25/56 (44%)
 Frame = -2

Query: 343 CFFSFNLRTASATRARCSNNLSTRSTGSCFLM**GAARALACR*SFCFRPRVSSSI 176
           C    +L   SAT A+C   +S+R+   CF           C+ + CF   ++ S+
Sbjct: 14  CLVILSLTVDSATAAQCGCCISSRAKACCFGCIAAGGSDSVCKNTCCFPCILADSV 69


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,483,226
Number of Sequences: 37544
Number of extensions: 314743
Number of successful extensions: 900
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 879
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 900
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1644004708
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -