SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B15
         (511 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_02_0040 + 4482853-4482988,4483111-4483224,4485372-4485514           90   8e-19
03_02_0370 + 7853646-7853772,7854508-7854621,7855152-7855294           89   1e-18
06_01_0239 - 1819316-1819458,1820578-1820691,1820794-1820923           86   1e-17
03_02_0020 - 5045900-5046211,5046233-5046290,5046604-5047242,504...    36   0.019
11_01_0676 - 5511755-5511831,5512857-5513052,5513462-5513577,551...    29   2.9  
06_02_0345 + 14833838-14833997,14834095-14834552,14834633-148348...    29   2.9  
03_06_0314 - 33077621-33077869,33078218-33078280,33079392-330794...    29   2.9  
01_05_0426 + 22042215-22042595,22044846-22045688                       27   6.6  
02_01_0686 + 5112712-5112942                                           27   8.8  

>10_02_0040 + 4482853-4482988,4483111-4483224,4485372-4485514
          Length = 130

 Score = 90.2 bits (214), Expect = 8e-19
 Identities = 41/72 (56%), Positives = 56/72 (77%)
 Frame = +1

Query: 112 AAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMP 291
           A   + G  +   +A    ++RIRITL+S+NV++LEKVCADL+ GAK ++LRVKGPVR+P
Sbjct: 9   AGGAMKGGKLGMEEARELQLNRIRITLSSKNVKNLEKVCADLVKGAKDKQLRVKGPVRIP 68

Query: 292 TKILRITTRKTP 327
           TK+L ITTRK+P
Sbjct: 69  TKVLHITTRKSP 80



 Score = 83.0 bits (196), Expect = 1e-16
 Identities = 38/48 (79%), Positives = 42/48 (87%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEG+ TWDRF+ RIHKRVIDL S  ++VKQITSI IEPGVEVEVTIAD
Sbjct: 82  GEGTNTWDRFEFRIHKRVIDLISSPDVVKQITSITIEPGVEVEVTIAD 129


>03_02_0370 + 7853646-7853772,7854508-7854621,7855152-7855294
          Length = 127

 Score = 89.4 bits (212), Expect = 1e-18
 Identities = 45/77 (58%), Positives = 59/77 (76%), Gaps = 4/77 (5%)
 Frame = +1

Query: 109 MAAAVV----SGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKG 276
           MAAA V     G  +   +A    ++RIRITL+S+NV++LEKVCADL+ GAK ++LRVKG
Sbjct: 1   MAAAAVYGGMKGGKLGVEEAHELQLNRIRITLSSKNVKNLEKVCADLVKGAKDKQLRVKG 60

Query: 277 PVRMPTKILRITTRKTP 327
           PVR+PTK+L ITTRK+P
Sbjct: 61  PVRIPTKVLHITTRKSP 77



 Score = 83.0 bits (196), Expect = 1e-16
 Identities = 38/48 (79%), Positives = 42/48 (87%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEG+ TWDRF+ RIHKRVIDL S  ++VKQITSI IEPGVEVEVTIAD
Sbjct: 79  GEGTNTWDRFEFRIHKRVIDLISSPDVVKQITSITIEPGVEVEVTIAD 126


>06_01_0239 - 1819316-1819458,1820578-1820691,1820794-1820923
          Length = 128

 Score = 86.2 bits (204), Expect = 1e-17
 Identities = 43/72 (59%), Positives = 55/72 (76%)
 Frame = +1

Query: 112 AAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMP 291
           A  + SGK   +   EV   HRIRITL+S++V++LEKVC DL+ GAK + L+VKGPVRMP
Sbjct: 9   APPMKSGKIGFESSQEVQ--HRIRITLSSKSVKNLEKVCGDLVKGAKDKSLKVKGPVRMP 66

Query: 292 TKILRITTRKTP 327
           TK+L ITTRK+P
Sbjct: 67  TKVLHITTRKSP 78



 Score = 84.2 bits (199), Expect = 5e-17
 Identities = 37/48 (77%), Positives = 44/48 (91%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEG+ TWDRF+MR+HKRVIDL S +++VKQITSI IEPGVEVEVTI+D
Sbjct: 80  GEGTNTWDRFEMRVHKRVIDLVSSADVVKQITSITIEPGVEVEVTISD 127


>03_02_0020 -
           5045900-5046211,5046233-5046290,5046604-5047242,
           5048475-5048515,5048672-5048728,5048952-5049140
          Length = 431

 Score = 35.9 bits (79), Expect = 0.019
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +1

Query: 160 VSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTK 297
           ++P  +IRI L S  V  +E  C  +I  AK    +  GPV +PTK
Sbjct: 329 LAPKQKIRIKLRSYWVPLIEDSCKKIIEAAKTTNAKTMGPVPLPTK 374



 Score = 30.3 bits (65), Expect = 0.94
 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +2

Query: 359 FQMRIHKRVIDLHSP-SEIVKQITSINIEPGVEVEVTI 469
           F++R H+R+ID+  P ++ +  +  + +  GV+VEV +
Sbjct: 394 FEIRTHQRLIDIMYPTAQTIDSLMQLQLPAGVDVEVKL 431


>11_01_0676 -
           5511755-5511831,5512857-5513052,5513462-5513577,
           5513752-5514597,5515515-5515766,5522344-5525206
          Length = 1449

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +3

Query: 111 GSRCSVRQRHRETPGRGLPYSP 176
           G  CS R+RHR   G  LP++P
Sbjct: 73  GVTCSRRRRHRRVTGLSLPHTP 94


>06_02_0345 +
           14833838-14833997,14834095-14834552,14834633-14834870,
           14834974-14835431,14836554-14836955
          Length = 571

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 5/48 (10%)
 Frame = +3

Query: 177 HQDHSYFSQCALTREGLC*PNQWSQETEAACKG--PSPH---ANQDPA 305
           H   S   +CAL R+G     +W  ET   C G  P+P     +QDPA
Sbjct: 11  HHLQSTLFECALLRDGRAESFEWLFETFKNCMGNCPTPRCILTDQDPA 58


>03_06_0314 -
           33077621-33077869,33078218-33078280,33079392-33079449,
           33079534-33079688,33079797-33080106,33080634-33080890,
           33081280-33081359,33083888-33083948
          Length = 410

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +3

Query: 204 CALTREGLC*PNQWSQETEAACKGPSP 284
           C L  EGL   ++W++   A  +GPSP
Sbjct: 155 CRLAAEGLVTASKWARPGRAGTRGPSP 181


>01_05_0426 + 22042215-22042595,22044846-22045688
          Length = 407

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 14/43 (32%), Positives = 15/43 (34%)
 Frame = +3

Query: 183 DHSYFSQCALTREGLC*PNQWSQETEAACKGPSPHANQDPAYH 311
           DH      A TR G+          E     P PH    PAYH
Sbjct: 13  DHGVRQVWADTRHGIAGGEHERVHAETFALAPQPHKQHRPAYH 55


>02_01_0686 + 5112712-5112942
          Length = 76

 Score = 27.1 bits (57), Expect = 8.8
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = +2

Query: 80  FISAGIQQA-TWQPL*CQAKTSRNPRQRSPLFTASGSLLLLAMCAHSRR 223
           FI A + +   W+    + K +RN R+R  LF     L  LA  A  RR
Sbjct: 6   FIGAALIEVWRWEERMVEKKRTRNTRERGGLFPRKLQLRALAAIARFRR 54


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,556,660
Number of Sequences: 37544
Number of extensions: 321089
Number of successful extensions: 864
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 841
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 864
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1095026320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -