SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0177 + 20669053-20669055,20669150-20669198,20669680-206699...   147   6e-36
04_03_0970 + 21338072-21338074,21338192-21338240,21338688-213389...   146   1e-35
01_07_0270 - 42417782-42417850,42418207-42418342,42418826-424191...   142   1e-34
01_07_0054 - 40779336-40779599,40779734-40779848,40779998-407801...    31   0.82 
05_03_0634 + 16432679-16433076,16433358-16433610,16433993-164342...    30   1.1  
06_03_0930 - 26038341-26038508,26039114-26039254,26040799-260408...    30   1.4  
06_01_1074 - 8765183-8765278,8765657-8765749,8766520-8766600,876...    29   1.9  
08_02_0802 + 21386248-21387468                                         29   2.5  
07_03_1296 + 25583195-25584385                                         29   2.5  
01_05_0305 + 20659199-20660026,20660147-20660179                       29   2.5  
03_06_0519 - 34481751-34482722                                         29   3.3  
01_01_0972 + 7672048-7672390,7672546-7672709,7672864-7672961,767...    29   3.3  
02_05_0460 - 29224525-29224620,29225525-29226625                       28   4.4  
12_02_0020 - 12388777-12389062,12389637-12389818                       28   5.8  
03_05_0528 - 25268396-25269217                                         28   5.8  
01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826...    28   5.8  
08_02_0955 + 22994266-22995630                                         27   7.7  

>02_04_0177 +
           20669053-20669055,20669150-20669198,20669680-20669962,
           20670526-20670661,20671014-20671094
          Length = 183

 Score =  147 bits (356), Expect = 6e-36
 Identities = 80/165 (48%), Positives = 105/165 (63%), Gaps = 7/165 (4%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M++PK+NR  I +YLF+EGV+ AKKDY+  KH +++ +PNLQVIK MQS KS+ YV+E F
Sbjct: 1   MIIPKKNRNEICKYLFQEGVLYAKKDYNLAKHPQID-VPNLQVIKLMQSFKSKEYVRETF 59

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRT--ETVRRGPVG-RPDAPARSAE 406
           +W+++YWYLTN+GIE+LR +L+LP EIVPATLK+S R        GP G RP  P R   
Sbjct: 60  SWQYYYWYLTNDGIEHLRNYLNLPSEIVPATLKKSARPPGRPFGSGPPGDRPRGPPRFEG 119

Query: 407 DRSAYRRTPAAPGVAPHDKKADVG--PGSADLEFKGGY--GRGRP 529
           DR  +       G  P     D G   G A  EF+  +    GRP
Sbjct: 120 DRPRFGDRDGYRG-GPRGAPGDFGGEKGGAPAEFQPSFRSSGGRP 163


>04_03_0970 +
           21338072-21338074,21338192-21338240,21338688-21338970,
           21339570-21339705,21339761-21339769
          Length = 159

 Score =  146 bits (353), Expect = 1e-35
 Identities = 77/158 (48%), Positives = 102/158 (64%), Gaps = 5/158 (3%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M++PK+NR  I +YLF+EGV+ AKKDY+  KH +++ +PNLQVIK MQS KS+ YV+E F
Sbjct: 1   MIIPKKNRNEICKYLFQEGVLYAKKDYNLAKHPQID-VPNLQVIKLMQSFKSKEYVRETF 59

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRT--ETVRRGPVG-RPDAPARSAE 406
           +W+++YWYLTN+GIE+LR +L+LP EIVPATLK+S R        GP G RP  P R   
Sbjct: 60  SWQYYYWYLTNDGIEHLRNYLNLPSEIVPATLKKSARPPGRPFGSGPPGDRPRGPPRFEG 119

Query: 407 DRSAYRRTPAAPGVAPHDKKADVG--PGSADLEFKGGY 514
           DR  +       G  P     D G   G A  EF+  +
Sbjct: 120 DRPRFGDRDGYRG-GPRGAPGDFGGEKGGAPAEFQPSF 156


>01_07_0270 -
           42417782-42417850,42418207-42418342,42418826-42419108,
           42419459-42419507,42419614-42419616
          Length = 179

 Score =  142 bits (345), Expect = 1e-34
 Identities = 75/163 (46%), Positives = 102/163 (62%), Gaps = 5/163 (3%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M++ K+NR  I +YLF EGV+ AKKDY+  KH +++ +PNL+VIK MQS KS+ YV+E F
Sbjct: 1   MIISKKNRREICKYLFHEGVLYAKKDYNLAKHPKVD-VPNLEVIKLMQSFKSKEYVRETF 59

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVR--TETVRRGPVG-RPDAPARSAE 406
           +W+H+YWYLTN+GIE+LR +L+LP E+VP TLK+S +  +     GP G RP  P R   
Sbjct: 60  SWQHYYWYLTNDGIEHLRSYLNLPSEVVPNTLKKSAKPPSRPFGSGPPGDRPRGPPRFEG 119

Query: 407 DRSAYRRTPAAPGVAPHDKKADVG--PGSADLEFKGGYGRGRP 529
           DR  +       G  P     D G   G A  EF+  +   RP
Sbjct: 120 DRPRFGDRDGYRG-GPRGAPGDFGGEKGGAPAEFQPSFRGSRP 161


>01_07_0054 -
           40779336-40779599,40779734-40779848,40779998-40780181,
           40780322-40780393,40780485-40780611,40780830-40781011,
           40781099-40781249
          Length = 364

 Score = 30.7 bits (66), Expect = 0.82
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 2/76 (2%)
 Frame = +2

Query: 86  IYEYLFKEGVMVA-KKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYL 262
           +Y+ L ++G +VA KK +  P H  + ++  L  I+    +   GY +E       Y Y+
Sbjct: 84  VYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYV 143

Query: 263 TNEGIE-YLRIFLHLP 307
            N  +  +L    H P
Sbjct: 144 PNGSVSTHLHGSSHAP 159


>05_03_0634 +
           16432679-16433076,16433358-16433610,16433993-16434291,
           16434553-16434729,16435001-16435621,16435690-16435784,
           16436000-16436088,16436185-16436250,16436475-16437026,
           16437879-16437953,16438305-16438375,16438456-16438513,
           16441506-16442048
          Length = 1098

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 8/83 (9%)
 Frame = +2

Query: 185 IKAMQSLKSRGYVKEQFAWRH---FYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTET 355
           I +   L S G       WR    F+ YLT E I YL   +HL  +   +T  RS+  + 
Sbjct: 605 ISSNAQLDSPGSANSSPFWRQVEPFFSYLTTEDIAYLSQQIHLSDD---STASRSIEGDE 661

Query: 356 VRRGP-----VGRPDAPARSAED 409
            R+       + +P  PA S +D
Sbjct: 662 SRKYKGSLEYISQPSTPAGSNKD 684


>06_03_0930 -
           26038341-26038508,26039114-26039254,26040799-26040858,
           26040972-26041034,26041444-26041454,26041722-26041802,
           26042783-26043020,26043563-26043997
          Length = 398

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 15/44 (34%), Positives = 23/44 (52%)
 Frame = +2

Query: 392 ARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRG 523
           AR    RS+ RR+P+  G A    +   G  ++ L++ GG G G
Sbjct: 58  ARGKRSRSSRRRSPSGSGSAATKGRWARGSPASPLDYSGGSGSG 101


>06_01_1074 -
           8765183-8765278,8765657-8765749,8766520-8766600,
           8767092-8767173,8767261-8767313,8767391-8767456,
           8767534-8767697,8768028-8768295
          Length = 300

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 18/44 (40%), Positives = 20/44 (45%)
 Frame = +2

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRP 529
           SA  RS  R TP  P + PH K+A   P S  L      G G P
Sbjct: 3   SAAPRS--RLTPPTPAMHPHRKRARSPPASGSLVRCSSSGNGAP 44


>08_02_0802 + 21386248-21387468
          Length = 406

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 1/65 (1%)
 Frame = -1

Query: 492 SAEPGPTSAFLS*GATPGAAGVRLYADLSSAE-RAGASGRPTGPRRTVSVRTERLSVAGT 316
           S  P P+S F       G   V    DLS A  R   + RP GPR  +  R E +++   
Sbjct: 123 SGSPEPSSGFFVAVVVDGEM-VLAAGDLSDAAYRRTRARRPAGPRPVLLSRREHVAMRDA 181

Query: 315 ISGGR 301
             GGR
Sbjct: 182 GRGGR 186


>07_03_1296 + 25583195-25584385
          Length = 396

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 5/70 (7%)
 Frame = +2

Query: 296 LHLPPEIVPATLKRSVR--TETVRRGPVGRPDAPARSAEDRSAYRRTPA---APGVAPHD 460
           LHL P   PA +KRS R  +  +   P    DA  R  ++  A+    +   AP +AP  
Sbjct: 76  LHLQPNPDPAEVKRSYRRLSNLLSSNPRPGADAALRCVQEAFAHLSDSSANPAPALAPPP 135

Query: 461 KKADVGPGSA 490
             A  G  SA
Sbjct: 136 APASGGDASA 145


>01_05_0305 + 20659199-20660026,20660147-20660179
          Length = 286

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 7/59 (11%)
 Frame = +2

Query: 296 LHLPPEI-----VPATLKRSVRTETVRRGPVG--RPDAPARSAEDRSAYRRTPAAPGVA 451
           L LPP +       A    S+   TV  GP G  +P  P   +   +++RR P+A GV+
Sbjct: 122 LKLPPRLQAAAAAAAAADSSLSPNTVLHGPYGGNKPPRPLTRSGSTASHRRKPSAVGVS 180


>03_06_0519 - 34481751-34482722
          Length = 323

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 18/59 (30%), Positives = 25/59 (42%)
 Frame = +2

Query: 359 RRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRPAS 535
           R+G  G    PA S+   +  RR+    G AP D  A+ GP S +           PA+
Sbjct: 23  RKGKRGAEAPPATSSSTPTTARRSKRLAG-APPDHPAEAGPSSTNARRSSRLAGAPPAT 80


>01_01_0972 +
           7672048-7672390,7672546-7672709,7672864-7672961,
           7673040-7673361,7674021-7675220
          Length = 708

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 2/88 (2%)
 Frame = +2

Query: 8   VPWLFLC*VSLQAAFKMLMPKQNRVAIYEYLFKEGVMVAK--KDYHAPKHTELEKIPNLQ 181
           V +LFL  V+  + F  L  +   +  Y+ ++  G  VA     +H PK     K+    
Sbjct: 150 VAFLFL--VTFSSLFCTLPLRNTMIVDYKLIYPSGSAVAGIVNSFHTPKGATKAKLQ--- 204

Query: 182 VIKAMQSLKSRGYVKEQFAWRHFYWYLT 265
            + AM   KS   V   FAW  F W+ T
Sbjct: 205 -VNAM--FKS---VAGSFAWAFFQWFYT 226


>02_05_0460 - 29224525-29224620,29225525-29226625
          Length = 398

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 17/41 (41%), Positives = 17/41 (41%)
 Frame = +2

Query: 368 PVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSA 490
           PV    APA  AE  S   R P  P   PH   A V   SA
Sbjct: 270 PVSPASAPAALAESSSEELRPPPLPSSHPHAHAAAVVAASA 310


>12_02_0020 - 12388777-12389062,12389637-12389818
          Length = 155

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +2

Query: 371 VGRPDAPARSAEDRSAYRRTPAAP 442
           +GRP    R  E+RS  +RTP+ P
Sbjct: 47  IGRPKGEGREWEERSRSQRTPSPP 70


>03_05_0528 - 25268396-25269217
          Length = 273

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = +2

Query: 479 PGSADLEFKGGYGRG 523
           PGS +LE  GGYG G
Sbjct: 106 PGSTELEINGGYGEG 120


>01_06_1758 -
           39681942-39682030,39682115-39682345,39682643-39682679,
           39683604-39683835,39683937-39684022,39684126-39684218,
           39684302-39684465,39684541-39684702,39684783-39684962,
           39685079-39685515,39685614-39685669
          Length = 588

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 23/62 (37%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
 Frame = +2

Query: 344 RTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAP--HDKKADVGPGSADLEFKGGYG 517
           R   +   PV    APA +    +AY   PAAP VAP   D     G G       GG+G
Sbjct: 17  RRSDLAGAPVLAASAPAAANPYAAAYAPAPAAP-VAPAGGDFSRFGGRGRGGGAGGGGWG 75

Query: 518 RG 523
           RG
Sbjct: 76  RG 77


>08_02_0955 + 22994266-22995630
          Length = 454

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 19/48 (39%), Positives = 23/48 (47%)
 Frame = -1

Query: 498 SRSAEPGPTSAFLS*GATPGAAGVRLYADLSSAERAGASGRPTGPRRT 355
           SRS  P   +A LS  +TP +A V   A   S   A A  R   PRR+
Sbjct: 45  SRSKTPPHNAAVLS--STPASAAVDFVAASDSDAGADADARLASPRRS 90


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,724,944
Number of Sequences: 37544
Number of extensions: 293566
Number of successful extensions: 979
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 951
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 975
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1269546012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -