SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B12
         (402 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_01_0089 + 633642-633644,633728-633863,635356-635457,635565-63...   102   1e-22
08_01_0195 + 1612938-1613003,1613026-1613161,1614624-1614725,161...   101   2e-22
02_05_1204 + 34936696-34936698,34936809-34936944,34937794-349378...   100   4e-22
11_06_0288 - 21962546-21962977,21963041-21963211,21963411-21963788     27   5.6  

>02_01_0089 +
           633642-633644,633728-633863,635356-635457,635565-635608
          Length = 94

 Score =  102 bits (244), Expect = 1e-22
 Identities = 42/81 (51%), Positives = 57/81 (70%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLC RCGR S+H+QKS C+ CGYPAA++R Y+WSVKA          MR+++ V R
Sbjct: 13  NKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTGTGRMRYMRHVPR 72

Query: 248 RFRNGFKEGKPTPPKKAVASS 310
           RF++ F+EG    P+K  A++
Sbjct: 73  RFKSNFREGTEATPRKRAAAA 93


>08_01_0195 +
           1612938-1613003,1613026-1613161,1614624-1614725,
           1614833-1614876
          Length = 115

 Score =  101 bits (242), Expect = 2e-22
 Identities = 42/79 (53%), Positives = 55/79 (69%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLC RCGR S+H+QKS C+ CGYPAA++R Y+WSVKA          MR+++ V R
Sbjct: 34  NKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTGTGRMRYMRHVPR 93

Query: 248 RFRNGFKEGKPTPPKKAVA 304
           RF++ F+EG    P+K  A
Sbjct: 94  RFKSNFREGTEATPRKRAA 112


>02_05_1204 +
           34936696-34936698,34936809-34936944,34937794-34937895,
           34938153-34938199
          Length = 95

 Score =  100 bits (240), Expect = 4e-22
 Identities = 42/81 (51%), Positives = 57/81 (70%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLC RCGR S+H+QKS C+ CGYPAA++R Y+WSVKA          MR+L+ V +
Sbjct: 13  NKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTGTGRMRYLRHVPK 72

Query: 248 RFRNGFKEGKPTPPKKAVASS 310
           RF++ F+EG    P+K  A++
Sbjct: 73  RFKSNFREGTEAAPRKKGAAA 93


>11_06_0288 - 21962546-21962977,21963041-21963211,21963411-21963788
          Length = 326

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 2/34 (5%)
 Frame = +1

Query: 145 ISCSKITILPLVSEG*AQEDYWNW--PHASFEDC 240
           I+   +T +  +S   + +D W W  PH  +EDC
Sbjct: 116 IALPPVTTIEQLSIARSGDDKWTWLPPHKDYEDC 149


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,074,411
Number of Sequences: 37544
Number of extensions: 166687
Number of successful extensions: 348
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 342
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 348
length of database: 14,793,348
effective HSP length: 75
effective length of database: 11,977,548
effective search space used: 694697784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -