SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B11
         (654 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_03_0108 - 12628711-12629178                                        200   6e-52
05_01_0438 + 3475017-3475484                                          200   8e-52
08_01_0570 - 5073138-5073410,5075386-5075530,5075561-5075754          136   2e-32
06_03_1097 - 27570037-27570262,27570575-27570730,27570763-275708...   136   2e-32
09_06_0335 + 22391378-22391480,22391580-22391769,22392747-223928...   135   3e-32
09_04_0354 + 16919133-16919235,16920145-16920355,16920478-169205...   135   3e-32
09_04_0148 + 15106392-15106484,15107517-15107776,15107920-15108028    135   3e-32
07_03_0427 - 18080959-18081079,18081203-18081410,18081608-18081710    135   3e-32
06_03_1149 + 28018932-28020529,28020989-28021067                      135   3e-32
04_04_1238 + 31997671-31998816                                        135   3e-32
03_02_0281 - 7069847-7069876,7070152-7070218,7071320-7071445,707...   135   3e-32
02_01_0464 - 3340642-3342015,3342403-3342405                          135   3e-32
01_06_0031 + 25760878-25761342                                        135   3e-32
09_04_0556 + 18500324-18500426,18501501-18501697,18501826-185018...   134   6e-32
09_04_0554 + 18495073-18495175,18495794-18496032                      134   8e-32
03_02_0429 + 8378819-8378921,8379098-8379282,8380054-8380120,838...   131   4e-31
05_03_0115 - 8544590-8544958,8545408-8545503,8561954-8562505,857...   131   5e-31
10_08_0470 - 18151326-18151769                                        122   3e-28
01_06_0033 + 25765300-25765758                                        120   8e-28
06_03_0944 + 26202053-26202229,26203788-26204047,26204145-262042...    93   3e-27
05_05_0090 - 22310424-22310489,22310768-22310871,22312048-22312198    109   2e-24
08_01_0571 - 5088060-5088314,5088826-5088868,5088911-5089137           92   3e-19
08_01_0566 - 5028512-5029150                                           91   5e-19
07_03_0447 + 18301421-18301520,18301900-18302060                       86   2e-17
10_08_0467 - 18143358-18143540,18144520-18144597,18144624-18145364     83   2e-16
10_08_0796 + 20643667-20643912                                         64   1e-10
10_08_0361 + 17207657-17207701,17208850-17209773                       57   1e-08
10_02_0200 - 6672743-6673717,6676257-6676634,6677017-6677301,667...    56   3e-08
03_06_0392 - 33583375-33583554,33583646-33584126,33584211-33584452     52   3e-07
12_01_1007 - 10208034-10208165,10208376-10208480,10208612-102086...    51   7e-07
11_03_0129 - 10447736-10448356,10450418-10450504,10450632-104507...    49   4e-06
08_02_0067 - 11863092-11863104,11863432-11863547,11863610-118639...    49   4e-06
02_01_0742 + 5524149-5524214,5524609-5524641,5524750-5524880,552...    48   5e-06
10_08_0468 - 18146369-18146701,18147267-18147467,18147525-181477...    47   2e-05
06_01_1069 + 8731567-8731632,8732120-8732281,8733028-8733081,873...    45   6e-05
10_08_0799 - 20650799-20650947,20651022-20651114,20651906-206519...    43   2e-04
03_01_0224 - 1771582-1771727,1771855-1771980,1772489-1772517,177...    43   2e-04
03_02_0430 + 8381641-8381743,8382799-8382956                           42   3e-04
06_03_0924 - 25976629-25976979,25977471-25978424,25978512-259785...    42   4e-04
12_01_1006 - 10206188-10206469                                         41   0.001
08_02_0751 + 20789843-20789908,20791152-20791313,20791516-207915...    40   0.001
09_04_0560 - 18519024-18519145,18519330-18519435,18519671-185199...    39   0.004
02_02_0500 - 10993675-10994067,10994434-10995738                       39   0.004
02_02_0240 + 8196140-8198248,8198381-8198650                           35   0.049
06_01_0365 + 2606873-2607787                                           35   0.065
06_02_0244 - 13445023-13445400,13445495-13446823                       34   0.086
01_06_0034 + 25769436-25769701,25769749-25769887                       34   0.086
06_01_1174 - 10025086-10027217,10027271-10027333,10027704-10027866     33   0.20 
05_07_0314 + 29162075-29163436,29163520-29163900,29164911-29165441     31   0.80 
02_04_0476 + 23248222-23248495,23249558-23249790                       31   0.80 
01_06_1727 + 39477107-39477395,39477493-39477722                       31   1.1  
10_08_0520 - 18495118-18498237                                         30   1.4  
09_04_0500 - 18120287-18122233                                         29   2.4  
11_01_0276 + 2057486-2057707                                           29   3.2  
08_02_1080 - 24197514-24199415                                         29   3.2  
12_01_0284 + 2117288-2117509                                           29   4.3  
08_02_1179 + 24969044-24969373                                         29   4.3  
04_04_0281 + 24121267-24121537,24122567-24122799                       29   4.3  
02_05_1315 + 35675285-35676688,35676816-35677255,35677341-35678784     29   4.3  
04_04_0291 - 24177550-24177731,24179855-24179921                       28   5.6  
01_06_1230 + 35575840-35576020,35576122-35576170,35576365-355764...    28   7.5  
04_04_1263 - 32207636-32207938,32208020-32208170,32208263-322085...    27   9.9  

>01_03_0108 - 12628711-12629178
          Length = 155

 Score =  200 bits (489), Expect = 6e-52
 Identities = 102/151 (67%), Positives = 112/151 (74%), Gaps = 1/151 (0%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDE-NGKIHRLRR 271
           IQKESTLHLV            K Y+ P          KLAVL+FYKVD+  GK+ RLR+
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRK 120

Query: 270 ECTGEQCGAGVFMAVMEDRHYCGKCHSTMVF 178
           EC   +CGAG FMA   DRHYCGKC  T V+
Sbjct: 121 ECPNAECGAGTFMANHFDRHYCGKCGLTYVY 151


>05_01_0438 + 3475017-3475484
          Length = 155

 Score =  200 bits (488), Expect = 8e-52
 Identities = 102/151 (67%), Positives = 111/151 (73%), Gaps = 1/151 (0%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDE-NGKIHRLRR 271
           IQKESTLHLV            K Y+ P          KLAVL+FYKVD+  GK+ RLR+
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRK 120

Query: 270 ECTGEQCGAGVFMAVMEDRHYCGKCHSTMVF 178
           EC    CGAG FMA   DRHYCGKC  T V+
Sbjct: 121 ECPNNDCGAGTFMANHFDRHYCGKCGLTYVY 151


>08_01_0570 - 5073138-5073410,5075386-5075530,5075561-5075754
          Length = 203

 Score =  136 bits (328), Expect = 2e-32
 Identities = 65/72 (90%), Positives = 70/72 (97%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           VKMQIFVKTLTGK+ITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLE+GRTL+D
Sbjct: 112 VKMQIFVKTLTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLAD 171

Query: 453 YNIQKESTLHLV 418
           YNIQKESTLHLV
Sbjct: 172 YNIQKESTLHLV 183


>06_03_1097 -
           27570037-27570262,27570575-27570730,27570763-27570881,
           27572154-27572236,27574991-27575041,27575218-27575674,
           27576139-27576228,27576672-27576701
          Length = 403

 Score =  136 bits (328), Expect = 2e-32
 Identities = 65/71 (91%), Positives = 69/71 (97%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           +MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DY
Sbjct: 40  QMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY 99

Query: 450 NIQKESTLHLV 418
           NIQKESTLHLV
Sbjct: 100 NIQKESTLHLV 110



 Score =  128 bits (308), Expect = 5e-30
 Identities = 62/70 (88%), Positives = 65/70 (92%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITL VE SD I+NVKAKIQDKEGIPP+QQRL FA KQLEDGRTL+DYN
Sbjct: 117 MQIFVKTLTGKTITLAVESSDKIDNVKAKIQDKEGIPPDQQRLIFADKQLEDGRTLADYN 176

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 177 IQKESTLHLV 186


>09_06_0335 +
           22391378-22391480,22391580-22391769,22392747-22392813,
           22393177-22393206
          Length = 129

 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>09_04_0354 +
           16919133-16919235,16920145-16920355,16920478-16920544,
           16920767-16920808
          Length = 140

 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>09_04_0148 + 15106392-15106484,15107517-15107776,15107920-15108028
          Length = 153

 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 41/68 (60%), Positives = 54/68 (79%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I VKTLTGK I +++EP+DTI+ +K ++++KEGIPP QQRL +AGKQL D +T  DYNI+
Sbjct: 79  IKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYNIE 138

Query: 441 KESTLHLV 418
             S LHLV
Sbjct: 139 GGSVLHLV 146


>07_03_0427 - 18080959-18081079,18081203-18081410,18081608-18081710
          Length = 143

 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>06_03_1149 + 28018932-28020529,28020989-28021067
          Length = 558

 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 381 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 457 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526


>04_04_1238 + 31997671-31998816
          Length = 381

 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  134 bits (324), Expect = 6e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>03_02_0281 -
           7069847-7069876,7070152-7070218,7071320-7071445,
           7071727-7071916,7072008-7072110
          Length = 171

 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>02_01_0464 - 3340642-3342015,3342403-3342405
          Length = 458

 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 2   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 61

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 62  IQKESTLHLV 71



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 78  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 137

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 138 IQKESTLHLV 147



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 154 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 213

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 214 IQKESTLHLV 223



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 230 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 289

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 290 IQKESTLHLV 299



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 306 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 365

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 366 IQKESTLHLV 375



 Score =  135 bits (327), Expect = 3e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 382 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 441

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 442 IQKESTLHLV 451


>01_06_0031 + 25760878-25761342
          Length = 154

 Score =  135 bits (326), Expect = 3e-32
 Identities = 64/70 (91%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAK+QDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIQNVKAKVQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 34/70 (48%), Positives = 52/70 (74%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + + V+TLTGK I +++E +DT++ +K +++++EGIPP QQRL + GKQL D +T  DY 
Sbjct: 77  LNVKVRTLTGKEIDIDIEMTDTVDRIKERVEEREGIPPVQQRLIYGGKQLADDKTAHDYK 136

Query: 447 IQKESTLHLV 418
           I+  S LHLV
Sbjct: 137 IEAGSVLHLV 146


>09_04_0556 +
           18500324-18500426,18501501-18501697,18501826-18501892,
           18502300-18502370
          Length = 145

 Score =  134 bits (324), Expect = 6e-32
 Identities = 64/70 (91%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQL+DGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>09_04_0554 + 18495073-18495175,18495794-18496032
          Length = 113

 Score =  134 bits (323), Expect = 8e-32
 Identities = 64/70 (91%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGK+ITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>03_02_0429 +
           8378819-8378921,8379098-8379282,8380054-8380120,
           8380516-8380544,8380739-8380774
          Length = 139

 Score =  131 bits (317), Expect = 4e-31
 Identities = 63/70 (90%), Positives = 66/70 (94%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SD + NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVENSDAVANVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>05_03_0115 -
           8544590-8544958,8545408-8545503,8561954-8562505,
           8576247-8576312,8576623-8576694,8576967-8577082,
           8577743-8577838,8578498-8578765
          Length = 544

 Score =  131 bits (316), Expect = 5e-31
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+ YN
Sbjct: 468 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAGYN 527

Query: 447 IQKESTLHL 421
           IQKESTLHL
Sbjct: 528 IQKESTLHL 536



 Score = 97.9 bits (233), Expect = 6e-21
 Identities = 50/74 (67%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQ-DKEGIPPNQQRLXFAGKQLEDGRTL 460
           R +MQIFVKTLTG TI L      T+   + + + DKEGIPP+QQRL FAGKQL+DGRTL
Sbjct: 388 RQQMQIFVKTLTGNTIRLSPLTRLTMSRPRFRTRRDKEGIPPDQQRLIFAGKQLKDGRTL 447

Query: 459 SDYNIQKESTLHLV 418
           +DYNIQKESTLHLV
Sbjct: 448 ADYNIQKESTLHLV 461


>10_08_0470 - 18151326-18151769
          Length = 147

 Score =  122 bits (294), Expect = 3e-28
 Identities = 70/144 (48%), Positives = 85/144 (59%), Gaps = 5/144 (3%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           V  QIFVK LTGKT  L +EPSDT+E+VK K+ DKEG+PP+QQ L F G QL+DG TL  
Sbjct: 4   VMTQIFVKGLTGKTTALRMEPSDTVESVKVKLVDKEGLPPDQQPLIFQGHQLDDGHTLIY 63

Query: 453 YNIQKESTLHL---VXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDE-NGKI 286
           Y IQ+ESTLHL   +            K Y+TP          +LAVLR Y+VD+  GK+
Sbjct: 64  YGIQEESTLHLLGRICGGGGGNKKRKKKAYATPKKGKHEHRKEELAVLRHYRVDDVMGKV 123

Query: 285 HRLRRECTGEQC-GAGVFMAVMED 217
            RLR  C   +C   G  MA   D
Sbjct: 124 ERLRLMCPNPECKDVGALMAKHHD 147


>01_06_0033 + 25765300-25765758
          Length = 152

 Score =  120 bits (290), Expect = 8e-28
 Identities = 55/70 (78%), Positives = 64/70 (91%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTL G+TITL V+  D++ENVKA+I D+EG+PP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLNGRTITLVVDSCDSVENVKARIHDREGVPPHQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 28/65 (43%), Positives = 43/65 (66%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I VK LTGK I +++EP+DT+  +K +I ++EG      RL + GKQL D +T+ +Y+I+
Sbjct: 80  IKVKMLTGKEIDVDIEPTDTMGRIKERIDEREG------RLVYGGKQLADDKTVHEYDIE 133

Query: 441 KESTL 427
             S L
Sbjct: 134 AGSVL 138


>06_03_0944 +
           26202053-26202229,26203788-26204047,26204145-26204245,
           26204512-26204584,26205482-26205581
          Length = 236

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 41/68 (60%), Positives = 54/68 (79%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I VKTLTGK I +++EP+DTI+ +K ++++KEGIPP QQRL +AGKQL D +T  DYNI+
Sbjct: 107 IKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYNIE 166

Query: 441 KESTLHLV 418
             S LHLV
Sbjct: 167 GGSVLHLV 174



 Score = 79.8 bits (188), Expect(2) = 3e-27
 Identities = 36/39 (92%), Positives = 38/39 (97%)
 Frame = -1

Query: 534 DKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           DKEGIPP+QQRL FAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 60  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 98



 Score = 60.1 bits (139), Expect(2) = 3e-27
 Identities = 29/31 (93%), Positives = 30/31 (96%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQ 535
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQ
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ 31


>05_05_0090 - 22310424-22310489,22310768-22310871,22312048-22312198
          Length = 106

 Score =  109 bits (262), Expect = 2e-24
 Identities = 52/60 (86%), Positives = 56/60 (93%)
 Frame = -1

Query: 597 KTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           + ITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDG TL+DYNIQKESTLHLV
Sbjct: 27  RVITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKESTLHLV 86


>08_01_0571 - 5088060-5088314,5088826-5088868,5088911-5089137
          Length = 174

 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 53/75 (70%), Positives = 59/75 (78%), Gaps = 4/75 (5%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL--XFAG-KQLED-GRT 463
           KMQI VKTLTG TITLEV PSDTI++VKAKIQDK GI  +QQ L    AG KQL+D G T
Sbjct: 91  KMQIIVKTLTGITITLEVRPSDTIDDVKAKIQDKVGIRSDQQHLVDVSAGSKQLDDGGST 150

Query: 462 LSDYNIQKESTLHLV 418
           L+DY+I  ESTLHLV
Sbjct: 151 LADYDIHDESTLHLV 165


>08_01_0566 - 5028512-5029150
          Length = 212

 Score = 91.5 bits (217), Expect = 5e-19
 Identities = 43/69 (62%), Positives = 53/69 (76%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFV+T+T   + +EV P DT+  VKAKIQ K GIP  QQRL FAG+ LEDGRTL++Y 
Sbjct: 1   MQIFVRTVTAGPLAVEVNPWDTVGKVKAKIQAKGGIPAAQQRLMFAGRHLEDGRTLAEYG 60

Query: 447 IQKESTLHL 421
           I+KE+ LHL
Sbjct: 61  IKKEANLHL 69


>07_03_0447 + 18301421-18301520,18301900-18302060
          Length = 86

 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 45/69 (65%), Positives = 52/69 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFV+TL  + ITLEVE SDTI +VK KI DK GIP + QRL  AG+QL+D RTL+DY 
Sbjct: 1   MQIFVRTLD-ECITLEVEGSDTIGDVKVKIHDKNGIPADDQRLMHAGRQLDDRRTLADYG 59

Query: 447 IQKESTLHL 421
           IQ E TL L
Sbjct: 60  IQTEHTLRL 68


>10_08_0467 - 18143358-18143540,18144520-18144597,18144624-18145364
          Length = 333

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 39/70 (55%), Positives = 53/70 (75%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           +MQI V  L G T TL VEPSDT+E+VK ++Q+K+G+PP QQRL F G+QL+DG T++  
Sbjct: 69  EMQILVSGLRGNTWTLWVEPSDTVESVKLQLQEKDGLPPCQQRLIFEGRQLDDGDTVASC 128

Query: 450 NIQKESTLHL 421
            I+K S L+L
Sbjct: 129 GIRKHSYLNL 138



 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 37/73 (50%), Positives = 53/73 (72%), Gaps = 3/73 (4%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTIT-LEVEPSDTIENVKAKI--QDKEGIPPNQQRLXFAGKQLEDGRTL 460
           +MQIFV+ L GK  T L+V+PSDT+ +VK K+  + K+   P +QRL F+G +L D RTL
Sbjct: 174 EMQIFVRVLGGKKATALKVQPSDTVGSVKVKLYYRKKKKTMPCKQRLVFSGMELADDRTL 233

Query: 459 SDYNIQKESTLHL 421
           + Y I++ESTL+L
Sbjct: 234 ASYGIEEESTLYL 246



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 37/69 (53%), Positives = 48/69 (69%), Gaps = 3/69 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLE--DG-RTLS 457
           MQI V  +TG T+TLEVEPSDT+E+VKAKI+   GI      L + GKQ++  DG RTL+
Sbjct: 1   MQIPVDLITGATLTLEVEPSDTVESVKAKIKAMSGI-TEDFGLAYDGKQMDEADGHRTLA 59

Query: 456 DYNIQKEST 430
           DY I+  +T
Sbjct: 60  DYGIRDPAT 68


>10_08_0796 + 20643667-20643912
          Length = 81

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 28/66 (42%), Positives = 43/66 (65%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           VKTLTGK + + +E ++T+  +K +++  EGIPP QQ L + G+QL D  T    +++  
Sbjct: 8   VKTLTGKEVEVSIEATETVARIKEQVEAAEGIPPPQQTLIYGGRQLADDMTAEMCDLRHG 67

Query: 435 STLHLV 418
           S LHLV
Sbjct: 68  SELHLV 73


>10_08_0361 + 17207657-17207701,17208850-17209773
          Length = 322

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 25/61 (40%), Positives = 43/61 (70%)
 Frame = -1

Query: 600 GKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           GKT  L +  S++I ++KA+I+ +EGI  N+Q L +AG+QLED + LS  +++ + T H+
Sbjct: 96  GKTTKLNMRKSNSIADIKAEIEQEEGILMNEQILMYAGQQLEDNQLLSQCDLRNDQTFHV 155

Query: 420 V 418
           +
Sbjct: 156 L 156



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 27/69 (39%), Positives = 45/69 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I+VK +  KT TL V  +DT++ +K+K+   EGI  ++Q + FAG  L++   L+DYN
Sbjct: 14  LKIYVKMM--KTFTLNVNSTDTVDQIKSKLSAIEGIDKSKQEMFFAGMHLKNEDKLADYN 71

Query: 447 IQKESTLHL 421
           I   S++ L
Sbjct: 72  IMTNSSVDL 80



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/69 (33%), Positives = 41/69 (59%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +Q FVK+  GKT+T+ ++ SDT + +K +I +K  I  +   L   G+ L    TL D+ 
Sbjct: 239 VQFFVKSWEGKTLTMVLKTSDTGKQIKDRIAEKLRIKESLYYLCHKGRVLLTEDTLLDHE 298

Query: 447 IQKESTLHL 421
           ++  ST+++
Sbjct: 299 VESNSTVYI 307



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL----XFAGKQLEDGRT 463
           K+ +F+     KTI LE +   T+ +VK  I++ EG+P   Q L       G  L DGR 
Sbjct: 162 KLHVFINVRGEKTIGLETKRWYTVADVKLMIENLEGLPACSQILTRMQSGVGVALTDGRM 221

Query: 462 LSDYNIQKESTLHL 421
           L D +++   TL L
Sbjct: 222 LQDQHVKNNDTLLL 235


>10_02_0200 -
           6672743-6673717,6676257-6676634,6677017-6677301,
           6677420-6677570,6677696-6677930,6678689-6678764
          Length = 699

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 28/71 (39%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLT-GKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M+I+VK  +  KTI L V+ S+++ +VK +I+ KEGI  + Q L +AG+QL+D + LS +
Sbjct: 427 MRIYVKIPSIAKTIKLIVKNSNSVADVKVEIERKEGILQDNQMLMYAGRQLDDRQILSHF 486

Query: 450 NIQKESTLHLV 418
            +  +  LH++
Sbjct: 487 GLSDDQILHVL 497



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 23/69 (33%), Positives = 37/69 (53%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +QIF+K+  G+T+T  V   DT E +  KI+ +  I   +  L + G  L  G +L  Y 
Sbjct: 580 VQIFIKSWEGRTLTTLVSMFDTAEEIWKKIKKRSQIKAEKYFLCYRGHVLPPGVSLDMYK 639

Query: 447 IQKESTLHL 421
           I+  ST+ +
Sbjct: 640 IESNSTISI 648



 Score = 36.3 bits (80), Expect = 0.021
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 4/74 (5%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGK----QLEDGRT 463
           K++IFV     +T+ L+VE   T+ +VK  I+   G P   Q L +       +L D  T
Sbjct: 503 KLRIFVNISNRRTVRLDVESWYTVADVKVMIEALLGFPACTQLLMWTNPSVDIELMDTET 562

Query: 462 LSDYNIQKESTLHL 421
           L + N++  + L L
Sbjct: 563 LKEQNVKNNTVLLL 576


>03_06_0392 - 33583375-33583554,33583646-33584126,33584211-33584452
          Length = 300

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 2/71 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDG-RTLSD 454
           M+I V+TL G  + L+V+  + T+  VK  +  +E I    QRL FAG+ L+D  RTL+D
Sbjct: 1   MRIMVRTLRGDRVALDVDGATTTVAQVKGMVMARERIAVAMQRLFFAGRCLDDDHRTLAD 60

Query: 453 YNIQKESTLHL 421
           Y ++ +S + L
Sbjct: 61  YGVRHDSVVFL 71


>12_01_1007 -
           10208034-10208165,10208376-10208480,10208612-10208673,
           10210820-10211456
          Length = 311

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 24/70 (34%), Positives = 42/70 (60%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ ++T+ G+  T+E+    T+  +K  +  +EGIP   QRL FAG +L+D      Y+
Sbjct: 1   MEVTLETVAGRRFTVEIWFFSTVRRIKEYVLRQEGIPVESQRLFFAGAELDDDGDTERYS 60

Query: 447 IQKESTLHLV 418
           I + ST+ L+
Sbjct: 61  ILQGSTVLLL 70


>11_03_0129 -
           10447736-10448356,10450418-10450504,10450632-10450742,
           10453876-10453935,10454262-10454345,10455200-10455298
          Length = 353

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 24/60 (40%), Positives = 38/60 (63%)
 Frame = -1

Query: 597 KTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           KTI L V+ SD + +VK +I+ KEGI  + Q L +AG+ L D + LS+  +  +  LH++
Sbjct: 163 KTIELSVKKSDIVADVKLQIELKEGIHLDNQILMYAGRHLGDSQILSECGLSDDHILHVL 222



 Score = 32.7 bits (71), Expect = 0.26
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP 514
           IF+KT  G+T+T+ V    T E++  KIQ K  I P
Sbjct: 307 IFIKTWEGRTLTMVVSSFHTEEDIWEKIQKKSMINP 342


>08_02_0067 -
           11863092-11863104,11863432-11863547,11863610-11863950,
           11864978-11865331,11866055-11866150,11866812-11866980,
           11867541-11867618,11867745-11867926,11868010-11868094,
           11868545-11868648,11869510-11869590,11870123-11870240,
           11871299-11871430,11871635-11871788,11871838-11871917
          Length = 700

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I +KTL  +T  L V     +  +K KI    GI   QQRL   G+ L+D   LS Y+
Sbjct: 103 IEIKIKTLDSQTYNLRVNKRVPVPLLKEKIATVTGILSEQQRLICRGRVLKDDELLSAYH 162

Query: 447 IQKESTLHLV 418
           ++   TLHLV
Sbjct: 163 VEDGHTLHLV 172


>02_01_0742 +
           5524149-5524214,5524609-5524641,5524750-5524880,
           5525174-5525282,5525406-5525522,5525896-5525961,
           5526314-5526376,5526459-5526503,5526690-5526751,
           5526974-5527067,5527375-5527467,5527561-5527630,
           5527816-5527892,5527976-5528033,5528135-5528166,
           5528245-5528376
          Length = 415

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 20/70 (28%), Positives = 44/70 (62%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ V T   + +T++V+P +++EN+KA ++ +  +P  QQ+L F G+++++   LS   
Sbjct: 1   MKVTVMTADEQILTVDVDPDESVENLKALLEVETSVPLRQQQLHFNGREIQNTDKLSTVG 60

Query: 447 IQKESTLHLV 418
           +Q    + +V
Sbjct: 61  VQDGDLVMMV 70


>10_08_0468 -
           18146369-18146701,18147267-18147467,18147525-18147773,
           18148058-18148090
          Length = 271

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 2/51 (3%)
 Frame = -1

Query: 576 EPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED--GRTLSDYNIQKEST 430
           EPSDT+E+VKAKI+D  GI  +   L + GKQ+++   RTL+DY I   +T
Sbjct: 17  EPSDTVESVKAKIKDMSGITEDFW-LRYDGKQMDEVGSRTLADYGIHDPAT 66



 Score = 36.3 bits (80), Expect = 0.021
 Identities = 16/28 (57%), Positives = 23/28 (82%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVK 547
           +M+IFV+ L G T TL V+PSDT+++VK
Sbjct: 67  EMEIFVRGLMGNTRTLWVKPSDTVKSVK 94


>06_01_1069 +
           8731567-8731632,8732120-8732281,8733028-8733081,
           8733557-8733630,8733706-8733786,8734902-8735079,
           8735336-8735506,8736113-8736202,8736284-8736331,
           8736447-8736562,8736655-8736733,8737101-8737223
          Length = 413

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           M++FVKTL G    +E  P  ++  VK  I+  +G    P +QQ L   GK L+D  TL 
Sbjct: 1   MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE 60

Query: 456 DYNIQKESTL 427
              + + S L
Sbjct: 61  GNKVAENSFL 70


>10_08_0799 -
           20650799-20650947,20651022-20651114,20651906-20651934,
           20652039-20652097,20652170-20652283,20652374-20652534,
           20652544-20652663,20652741-20653469,20654980-20655244
          Length = 572

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/68 (26%), Positives = 35/68 (51%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           + ++   G   T+  +   T+   K  +     +P  QQRL + G+ L+D +TL  Y ++
Sbjct: 32  LHIRCANGSKFTVRADLDATVGAFKEVVAGSCDVPAAQQRLIYKGRILKDEQTLESYGVE 91

Query: 441 KESTLHLV 418
            + T+H+V
Sbjct: 92  TDHTIHMV 99


>03_01_0224 -
           1771582-1771727,1771855-1771980,1772489-1772517,
           1772689-1772747,1772816-1772929,1773030-1773238,
           1773347-1774087,1775678-1776238,1776295-1776419,
           1778187-1778317,1779020-1779178,1779471-1779728,
           1780140-1780164,1780531-1780592,1780944-1781003,
           1781112-1781219,1781703-1781838,1781880-1781929,
           1782024-1782096,1782209-1782345,1782441-1782527,
           1782624-1782721,1783259-1783369,1783685-1783769,
           1783880-1783969
          Length = 1259

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 17/68 (25%), Positives = 38/68 (55%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           + ++   G  + +  +   ++   KA + +   +P  QQRL + G+ L+D +TL+ Y ++
Sbjct: 729 LHIRCTNGSKLAVRADLGLSVGAFKAIVAESCDVPAPQQRLIYKGRILKDEQTLASYGVE 788

Query: 441 KESTLHLV 418
            + T+H+V
Sbjct: 789 TDHTIHMV 796


>03_02_0430 + 8381641-8381743,8382799-8382956
          Length = 86

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/36 (58%), Positives = 27/36 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI 520
           M+I+VKTL G+ I+LEV  SDTI +VK KI  + GI
Sbjct: 1   MRIYVKTLKGRIISLEVARSDTIASVKDKIYAERGI 36


>06_03_0924 -
           25976629-25976979,25977471-25978424,25978512-25978565,
           25979135-25979254,25979357-25979532,25979624-25980107,
           25980541-25980744,25981671-25981877,25982179-25982271,
           25982433-25982621,25983364-25983423,25983591-25983927,
           25984195-25984432,25984614-25984816,25985549-25986554,
           25987125-25987290,25987715-25987824,25987944-25988195,
           25988360-25988402,25988488-25988550,25989512-25989624,
           25990787-25990838
          Length = 1824

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQ-RLXFAGKQLEDGRTLSDY 451
           M   V TL GK +   V   +T  +VK+K   K    P+++ +L  +GK+L+D  +L+  
Sbjct: 636 MTAIVMTLGGKGVKFLVNAEETPLSVKSKASKKLEFKPSEKIKLFCSGKELQDDISLAMQ 695

Query: 450 NIQKESTLHLV 418
           N++  S LH+V
Sbjct: 696 NVRPNSILHVV 706


>12_01_1006 - 10206188-10206469
          Length = 93

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 2/63 (3%)
 Frame = -1

Query: 600 GKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED--GRTLSDYNIQKESTL 427
           G++ T E+  + +++ +K  + ++EG P   QR  F G ++++    T  +Y+I K ST+
Sbjct: 19  GRSFTAEIGSTSSLQRMKTAVMNQEGFPVQHQRPFFGGVEMQEKGDDTTREYSIVKGSTI 78

Query: 426 HLV 418
            L+
Sbjct: 79  DLL 81


>08_02_0751 +
           20789843-20789908,20791152-20791313,20791516-20791566,
           20792096-20792160,20792385-20792459,20792603-20792780,
           20793171-20793353,20793436-20793549,20793627-20793736,
           20793826-20793904,20794035-20794172
          Length = 406

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 3/64 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           M++ +KTL G +  ++VEP+  + +VK  I+  +G    P +QQ L   G  L++  TL 
Sbjct: 1   MKVSIKTLKGSSFEIDVEPTSKVSDVKKLIEVTQGDNVYPADQQMLIHQGNVLKNDTTLE 60

Query: 456 DYNI 445
           +  +
Sbjct: 61  ENKV 64


>09_04_0560 -
           18519024-18519145,18519330-18519435,18519671-18519907,
           18521371-18521810,18523215-18525012
          Length = 900

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 22/67 (32%), Positives = 36/67 (53%)
 Frame = -1

Query: 618 FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQK 439
           FV+    +T+++     DT+  V A + D+ G      RL +AG+QL     L+D  +  
Sbjct: 83  FVRATDSRTVSMHAAWGDTVGAVLAHLADR-GYG-RDLRLVYAGRQLAPETALADLRLPP 140

Query: 438 ESTLHLV 418
           +STLHL+
Sbjct: 141 DSTLHLL 147


>02_02_0500 - 10993675-10994067,10994434-10995738
          Length = 565

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLE-DGRTLSDYNIQKESTLHLV 418
           + V  SD++ +VK +IQ  +G    +QRL F+G +L  +   + DY +   + LHLV
Sbjct: 46  MRVLHSDSVASVKLRIQQFKGFVTTKQRLVFSGHELSLNNSHVRDYGLTDGNVLHLV 102



 Score = 35.5 bits (78), Expect = 0.037
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQ---QRLXFAGKQLEDGRTLSDY 451
           I ++T  GK    +VE    +  +K K+  + G        QRL F G++LED + ++D 
Sbjct: 111 ISIETANGKKFQFQVESCCNVGYLKDKLSAESGQQLGSLKDQRLVFDGEELEDNQLIADI 170

Query: 450 NIQKESTLHL 421
           + +  + +HL
Sbjct: 171 SKKGAAVIHL 180


>02_02_0240 + 8196140-8198248,8198381-8198650
          Length = 792

 Score = 35.1 bits (77), Expect = 0.049
 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = -1

Query: 606 LTGKTITLEVEP-SDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           L G+ + + V+  SDT+ ++K +I  +  +P N+Q+L      L+D  TL+ YNI
Sbjct: 720 LRGQVLEIGVQSLSDTVGSLKEQIAGELQLPANKQKLSVRTSFLKDNLTLAYYNI 774


>06_01_0365 + 2606873-2607787
          Length = 304

 Score = 34.7 bits (76), Expect = 0.065
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = -1

Query: 591 ITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           +T+ VEP D +  +K K++   GIP   Q L +  ++L D   +  Y I
Sbjct: 18  LTVVVEPFDKVVEIKQKVESCYGIPVTAQCLLYWNRELADDHDIEYYPI 66


>06_02_0244 - 13445023-13445400,13445495-13446823
          Length = 568

 Score = 34.3 bits (75), Expect = 0.086
 Identities = 18/69 (26%), Positives = 41/69 (59%), Gaps = 2/69 (2%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAK--IQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           I ++T +GK    +V+ S  ++ +K+K  ++  E +  +  +L   GK+LED + ++D +
Sbjct: 119 INIETTSGKKFQFQVDQSRNVKYLKSKLAVEGDEDLGEDH-KLECDGKELEDHQLIADIS 177

Query: 447 IQKESTLHL 421
            + ++ +HL
Sbjct: 178 KKDDAVIHL 186


>01_06_0034 + 25769436-25769701,25769749-25769887
          Length = 134

 Score = 34.3 bits (75), Expect = 0.086
 Identities = 17/23 (73%), Positives = 18/23 (78%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTI 559
           MQI V+T  GK ITLEVE SDTI
Sbjct: 1   MQIVVETQMGKLITLEVESSDTI 23


>06_01_1174 - 10025086-10027217,10027271-10027333,10027704-10027866
          Length = 785

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 15/51 (29%), Positives = 28/51 (54%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED 472
           +IFV+T TG  + ++++  D    VK K+Q    +P  +  L F  + L++
Sbjct: 176 RIFVQTDTGCVLAVQLDRGDNAHTVKRKLQLALNVPTEESSLTFGDRVLKN 226


>05_07_0314 + 29162075-29163436,29163520-29163900,29164911-29165441
          Length = 757

 Score = 31.1 bits (67), Expect = 0.80
 Identities = 18/68 (26%), Positives = 29/68 (42%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I V+T+ G      VEP  T+  VK +I        +   L   G+ L+D   + D    
Sbjct: 119 ITVQTVHGNKFRFRVEPGRTVGYVKQQIAKNSTHDDDHHSLVLQGEVLDDAHLIHDVCRT 178

Query: 441 KESTLHLV 418
             + +HL+
Sbjct: 179 DGAVIHLL 186


>02_04_0476 + 23248222-23248495,23249558-23249790
          Length = 168

 Score = 31.1 bits (67), Expect = 0.80
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = -1

Query: 621 IFVKTLTGKTI-TLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED 472
           I V+  TG     + +  + T   +K ++    G+ P +QRL F GK+ ED
Sbjct: 70  ILVRVSTGFAWHDVSIAATSTFGELKVRLSMVTGLEPREQRLLFRGKERED 120


>01_06_1727 + 39477107-39477395,39477493-39477722
          Length = 172

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = -1

Query: 621 IFVKTLTG-KTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           I V+  TG +   + ++ + T  ++K  +    G+ P  QRL + GK+ +DG  L    +
Sbjct: 75  IVVRVSTGWQWHDVSIDSTATFGDLKVMLSLVTGLWPRDQRLLYKGKERDDGDHLHMVGV 134

Query: 444 QKESTLHLV 418
           Q +  + L+
Sbjct: 135 QDKDKVLLL 143


>10_08_0520 - 18495118-18498237
          Length = 1039

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 5/72 (6%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSD-TIENVKAKIQDK-EGIPPNQQRLXFAGKQL---EDGRTLS 457
           +FV+   G+T  ++++PS  T+ ++ A       G+PP Q RL  A ++L   E    LS
Sbjct: 2   VFVRAPDGRTHHVDLDPSTATLADLTASASRVCGGVPPEQLRLYLAHRRLLPAEPSPLLS 61

Query: 456 DYNIQKESTLHL 421
              +   S+L L
Sbjct: 62  SLRVSASSSLLL 73


>09_04_0500 - 18120287-18122233
          Length = 648

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXF 493
           ++FV+T  G  + +E+E  +    VK K+Q    +P  +  L F
Sbjct: 29  RVFVQTENGYVLGIELERGENAHTVKKKLQVALKVPTEESSLTF 72


>11_01_0276 + 2057486-2057707
          Length = 73

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 17/69 (24%), Positives = 31/69 (44%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ +    GK + ++    DTI ++K  +  + G  P + R+       +D  TL DY 
Sbjct: 2   IEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYNIYKDHITLKDYE 61

Query: 447 IQKESTLHL 421
           I     L L
Sbjct: 62  IHDGMGLEL 70


>08_02_1080 - 24197514-24199415
          Length = 633

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQL 478
           ++FV+T  G  + +E+E  +    VK K+Q    IP  +  L   G QL
Sbjct: 29  RVFVQTDKGSVLGIELERGENAHTVKKKLQLALNIPTEESSLT-CGDQL 76


>12_01_0284 + 2117288-2117509
          Length = 73

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 17/69 (24%), Positives = 31/69 (44%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ +    GK + ++    DTI ++K  +  + G  P + R+       +D  TL DY 
Sbjct: 2   IEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYNIYKDHITLRDYE 61

Query: 447 IQKESTLHL 421
           I     L L
Sbjct: 62  IHDGMGLEL 70


>08_02_1179 + 24969044-24969373
          Length = 109

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 3/29 (10%)
 Frame = -3

Query: 481 AGRWTYPXGLQYPEG---IHPPPGVEASW 404
           AGRWT P   + P+G     PPPG    W
Sbjct: 24  AGRWTTPGHEERPKGHLFNRPPPGESRKW 52


>04_04_0281 + 24121267-24121537,24122567-24122799
          Length = 167

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/49 (28%), Positives = 24/49 (48%)
 Frame = -1

Query: 564 TIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           T   +K  +    G+ P +QRL F GK+ ED   L    ++ +  + L+
Sbjct: 89  TFGELKTVVSIVTGLEPREQRLLFRGKEREDSDHLHMVGVRDKDKVLLL 137


>02_05_1315 + 35675285-35676688,35676816-35677255,35677341-35678784
          Length = 1095

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 10/32 (31%), Positives = 20/32 (62%)
 Frame = +1

Query: 439 LLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFV 534
           L+D+V+   T   Q++S   QP+ +G + +F+
Sbjct: 866 LIDVVITANTENCQVISGSIQPITVGIEDMFL 897


>04_04_0291 - 24177550-24177731,24179855-24179921
          Length = 82

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 552 VKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           +KA +    G+ P +QR  F GK+ ED   L D
Sbjct: 25  LKAVVSMVTGLEPREQRPLFRGKEREDSDHLKD 57


>01_06_1230 +
           35575840-35576020,35576122-35576170,35576365-35576441,
           35576883-35577145,35577241-35577387,35578569-35578766
          Length = 304

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = -1

Query: 552 VKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           +K  +    G+ P +QRL F GK+  D   L    ++  + L L+
Sbjct: 105 LKGVLTQATGVEPERQRLFFRGKEKSDNEFLHTAGVKDGAKLLLL 149


>04_04_1263 - 32207636-32207938,32208020-32208170,32208263-32208500,
            32208604-32208814,32208927-32209108,32209196-32209297,
            32210002-32211187,32212103-32212499,32212551-32212582,
            32212885-32213157,32213307-32213394,32213486-32213723,
            32213824-32214034,32214119-32214300,32214378-32214479,
            32214801-32216224,32216751-32216822,32217688-32217719,
            32218186-32218263,32218425-32218512,32218608-32218845,
            32219060-32219162,32219386-32219558,32219644-32219745,
            32219825-32220606,32220659-32221012,32224055-32224140,
            32224250-32224400,32224534-32224771,32224876-32225119,
            32225190-32225368,32225577-32225675,32225835-32227083
          Length = 3195

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = +3

Query: 420  PGGGWIPSGYCSPXGYVHLPAAFQQ 494
            PG G +  G C P GY  +  +FQ+
Sbjct: 986  PGHGCLHYGACGPFGYCDITGSFQE 1010


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,931,099
Number of Sequences: 37544
Number of extensions: 286610
Number of successful extensions: 876
Number of sequences better than 10.0: 62
Number of HSP's better than 10.0 without gapping: 809
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 865
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1632177336
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -