SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B08
         (510 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0519 - 19945456-19945653,19947110-19947112                       52   4e-07
11_06_0495 - 24319531-24320831,24320923-24321109,24322919-243230...    46   2e-05
05_03_0318 - 12292969-12293222,12293305-12293898,12297102-122974...    30   1.2  
11_06_0413 - 23242228-23242517,23242732-23243180,23243338-23244458     27   6.6  
01_06_1306 + 36151907-36154369                                         27   6.6  
04_03_0830 - 20125827-20125913,20126262-20126357,20126974-201270...    27   8.8  

>12_02_0519 - 19945456-19945653,19947110-19947112
          Length = 66

 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 23/37 (62%), Positives = 28/37 (75%)
 Frame = +1

Query: 145 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGS 255
           KNIT RG+VP+TT +K + YPV P +L  FIFVV GS
Sbjct: 17  KNITKRGSVPETTVKKGNDYPVGPMVLGFFIFVVIGS 53


>11_06_0495 -
           24319531-24320831,24320923-24321109,24322919-24323062,
           24324467-24324469
          Length = 544

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 20/33 (60%), Positives = 25/33 (75%)
 Frame = +1

Query: 145 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFV 243
           KNIT RG+VP+TT +K + YPV P +L  FIFV
Sbjct: 17  KNITKRGSVPETTVKKGNDYPVGPLVLGFFIFV 49


>05_03_0318 -
           12292969-12293222,12293305-12293898,12297102-12297415,
           12297712-12297893,12297960-12298187,12298234-12298698,
           12299393-12299443
          Length = 695

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +3

Query: 258 CVPDNPINKTSLNHEDNWRTAIENTIK*QHYPSKV-RHNLHQHLFVDMRE 404
           CV     +  S+   D W+T + N  + + Y S + RH+L Q  F+++ E
Sbjct: 206 CVEGKAKDARSITSGDGWKTRVLNRKEVRSYTSDLKRHDLRQQDFLNLEE 255


>11_06_0413 - 23242228-23242517,23242732-23243180,23243338-23244458
          Length = 619

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 21/69 (30%), Positives = 33/69 (47%)
 Frame = +2

Query: 8   YLRVKRNCALWLFESF*FIIKLTNILYNKTKWPLSRECVSPTRSPVKTSQ*GGMYPKLPR 187
           +L+VKRN ++   E    I  L ++  +    PLSR+  SP  S    S       +LPR
Sbjct: 422 HLKVKRNSSVGKSEKAAVIRALRSM--DLEGHPLSRDLPSPRVSDRAESYWLACLEELPR 479

Query: 188 KKKTNILWH 214
             +  ++WH
Sbjct: 480 CSRVILVWH 488


>01_06_1306 + 36151907-36154369
          Length = 820

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = +3

Query: 153 HNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPDNPI 278
           ++ G   ++  G     SC +L+PC+    S  L  VP  P+
Sbjct: 153 YSGGSSVESPDGSSAANSCNSLSPCNCSSSSDGLGAVPQTPV 194


>04_03_0830 -
           20125827-20125913,20126262-20126357,20126974-20127053,
           20127124-20127220,20127457-20127544,20128491-20128576,
           20129358-20130530
          Length = 568

 Score = 27.1 bits (57), Expect = 8.8
 Identities = 13/34 (38%), Positives = 17/34 (50%)
 Frame = -1

Query: 261 HSRATHYEDEESKEPGCHRILVFFFLGSFGYIPP 160
           HS A + +D+E +    HRI    F G  G  PP
Sbjct: 284 HSAAGNGDDDEYESTQQHRIKCAGFFGGLGAAPP 317


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,700,469
Number of Sequences: 37544
Number of extensions: 282610
Number of successful extensions: 642
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 627
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 642
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1095026320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -