SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B07
         (652 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_04_0741 - 19852339-19852497,19853185-19853246,19853352-198534...    29   3.2  
11_03_0044 - 9198016-9199143,9199579-9199674,9199771-9199846,920...    29   4.2  
01_06_0337 - 28535265-28535381,28535463-28535573,28535686-285358...    29   4.2  
01_06_1785 - 39859790-39860671                                         27   9.8  

>09_04_0741 -
           19852339-19852497,19853185-19853246,19853352-19853415,
           19853561-19853614,19853744-19853890,19854460-19854564,
           19854651-19854794,19854987-19855093,19855613-19855712,
           19855804-19855833,19856492-19856608,19856705-19856828,
           19857143-19857189,19857272-19857400,19857777-19857852,
           19858446-19858543,19858630-19858671,19858811-19859044
          Length = 612

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = +3

Query: 507 SLACAIDRQYLVYSRKYLPTWEHLFSS 587
           S +CA++R +L + R Y+ +W   F S
Sbjct: 255 SYSCALERSFLYHGRMYVSSWHICFHS 281


>11_03_0044 -
           9198016-9199143,9199579-9199674,9199771-9199846,
           9200330-9200547,9200703-9200918,9201336-9201521,
           9201607-9201708,9201828-9202495,9203248-9203314
          Length = 918

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 3/38 (7%)
 Frame = +3

Query: 12  IEHLTI---NVI*ILVCE**CQFLLPVIILKVLVMFRA 116
           I HLTI   N++  L+ +  C FLL +I+ K   MFRA
Sbjct: 215 IAHLTIGSTNILLSLISQYICIFLLEIILNKAYKMFRA 252


>01_06_0337 -
           28535265-28535381,28535463-28535573,28535686-28535840,
           28536121-28536230,28536607-28536703,28536878-28537031,
           28537260-28537313,28537528-28537588,28537915-28537984,
           28538079-28538163,28538325-28538423,28538553-28538639
          Length = 399

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = +2

Query: 221 RRLTEKVRRETQWAVLIYSSSPSSQAKGWRRAVTGACGT 337
           R + E +      AV IY +  +SQA GW  +V GA GT
Sbjct: 6   RAVVEAIHSSRAQAV-IYLAGGASQALGWLLSVPGASGT 43


>01_06_1785 - 39859790-39860671
          Length = 293

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +1

Query: 196 RVDLRGSNQKTH*EGPARNSVGCVNLLVEPFVASEGLAEGGD 321
           R  LRG    +   G    +  C++ LV+ F+ +EG A G D
Sbjct: 12  RARLRGDAGSSASSGSEHEASACLSGLVQAFLETEGAAAGED 53


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,816,261
Number of Sequences: 37544
Number of extensions: 340603
Number of successful extensions: 789
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 769
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 789
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1620349964
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -