SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B05
         (653 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_04_0317 - 16328558-16328612,16328698-16328901,16329794-163300...   275   2e-74
01_01_0006 + 26221-26292,26370-26641,27090-27293,27365-27419          270   9e-73
07_03_0100 + 13389899-13390219,13390723-13390841,13391220-133913...    32   0.35 
04_04_0446 - 25288154-25288863,25288949-25289135,25289331-25291061     31   1.1  
07_01_0077 + 566895-567127,567207-567331,571204-571340,571437-57...    29   4.3  
03_06_0610 + 35052455-35053429,35054936-35055511                       29   4.3  
06_02_0103 - 11829343-11829699,11831560-11831826,11832239-118325...    28   7.5  
07_03_1503 + 27017933-27018063,27019668-27019727,27019996-270201...    27   9.9  
05_05_0116 - 22496535-22496576,22496974-22497058,22497468-224975...    27   9.9  
04_04_1155 - 31308704-31309051,31309301-31309451,31309532-313097...    27   9.9  
01_07_0219 + 42079095-42079399,42079584-42079728,42081695-420817...    27   9.9  

>11_04_0317 -
           16328558-16328612,16328698-16328901,16329794-16330065,
           16330152-16330220
          Length = 199

 Score =  275 bits (675), Expect = 2e-74
 Identities = 132/164 (80%), Positives = 148/164 (90%), Gaps = 1/164 (0%)
 Frame = +2

Query: 164 EIKLFGRWSCYDVQVSDMSLQDYISVKE-KYAKYLPHSAGRYAHKRFRKAQCPIVERLTN 340
           E+KLF RWS  DVQV+D+SL DY++V   K+A YLPH+AGRY+ KRFRKAQCPIVERLTN
Sbjct: 10  EVKLFSRWSFEDVQVNDISLADYLAVNPTKHATYLPHTAGRYSAKRFRKAQCPIVERLTN 69

Query: 341 SLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTV 520
           SLMMHGRNNGKK+MAVRIVKHA EIIHLLT  NP+QV+V AIINSGPRED+TRIG AG V
Sbjct: 70  SLMMHGRNNGKKIMAVRIVKHAMEIIHLLTDANPIQVIVDAIINSGPREDATRIGSAGAV 129

Query: 521 RRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           RRQAVD+SPLRRVNQAI+LL TGARE+AFRNIKTIAEC+ADELI
Sbjct: 130 RRQAVDISPLRRVNQAIYLLTTGARESAFRNIKTIAECLADELI 173


>01_01_0006 + 26221-26292,26370-26641,27090-27293,27365-27419
          Length = 200

 Score =  270 bits (661), Expect = 9e-73
 Identities = 129/163 (79%), Positives = 146/163 (89%), Gaps = 1/163 (0%)
 Frame = +2

Query: 167 IKLFGRWSCYDVQVSDMSLQDYISVKE-KYAKYLPHSAGRYAHKRFRKAQCPIVERLTNS 343
           +KLF  WS  DVQV+D+SL DY++V   K+A YLPH+AGRY+ KRFRKAQCP+VERLTNS
Sbjct: 12  VKLFNCWSFEDVQVNDISLADYLAVSSTKHATYLPHTAGRYSAKRFRKAQCPLVERLTNS 71

Query: 344 LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR 523
           LMMHGRNNGKK+MAVRIVKHA EIIHLLT  NP+QV+V AIINSGPRED+TRIG AG VR
Sbjct: 72  LMMHGRNNGKKIMAVRIVKHAMEIIHLLTDANPIQVIVDAIINSGPREDATRIGSAGAVR 131

Query: 524 RQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           RQAVD+SPLRRVNQAI+LL TGARE+AFRNIKTIAEC+ADELI
Sbjct: 132 RQAVDISPLRRVNQAIYLLTTGARESAFRNIKTIAECLADELI 174


>07_03_0100 +
           13389899-13390219,13390723-13390841,13391220-13391315,
           13391481-13391553,13392055-13392123
          Length = 225

 Score = 32.3 bits (70), Expect = 0.35
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = -3

Query: 609 LNAASRAPVHKSQIAWLTRRKGETSTA*RRTVPARPILVESSRGPE 472
           L+A+SR P  + +I    RR+G + +  RR+ P +P     +R PE
Sbjct: 49  LHASSRVPAARHRIVCPCRRRGGSPSLTRRSSPEKPGPFSQTRSPE 94


>04_04_0446 - 25288154-25288863,25288949-25289135,25289331-25291061
          Length = 875

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 23/92 (25%), Positives = 39/92 (42%)
 Frame = +2

Query: 107 EAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRY 286
           +AGS+ V   S   + D+ E+K  G       + S  S+ D  +V E      P S+ R 
Sbjct: 578 DAGSIEVPVSSDCVSGDVDEVKSNGDLKSIHDETSPTSILD--TVFEDSNSNEPESSRRT 635

Query: 287 AHKRFRKAQCPIVERLTNSLMMHGRNNGKKLM 382
           +       +CP ++ +  S      N+G  L+
Sbjct: 636 SCTERVALRCPAIDSVARSFSWEDTNSGSPLL 667


>07_01_0077 +
           566895-567127,567207-567331,571204-571340,571437-571542,
           571635-571885,572018-572128,572209-572320,572626-572716,
           573168-573507,573678-573900,573946-574204,574274-574481,
           574572-574622,574712-574870,574956-575120,575322-575399,
           575732-576031,576107-576259,576871-576918,577019-577188,
           577738-577852,578462-578623,578789-578893,578969-579199,
           579277-579410,579484-579738,579822-580110,580214-580306,
           580395-580520,580646-580897
          Length = 1693

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = +3

Query: 99  T*PRQAAWLWKPCLYHKPPTF 161
           T P Q +WLW+  L H P  F
Sbjct: 88  TDPSQCSWLWREVLKHNPDAF 108


>03_06_0610 + 35052455-35053429,35054936-35055511
          Length = 516

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 4/62 (6%)
 Frame = -2

Query: 217 HIRDLHIVATPSAEKLDFR---NVGGLW*RHGFHN-HAACLGYVVIPVLLGHDWYFSITK 50
           ++   ++V TP A  L F      GGLW  +G  +  AAC+  V++ V+   DW+    +
Sbjct: 418 NLLSFYLVGTPVAVTLAFGARVGFGGLW--YGLLSAQAACVALVLLAVVWRTDWHLEALR 475

Query: 49  *K 44
            K
Sbjct: 476 AK 477


>06_02_0103 -
           11829343-11829699,11831560-11831826,11832239-11832559,
           11833783-11833844,11835413-11835446,11835539-11835619
          Length = 373

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 16/57 (28%), Positives = 31/57 (54%)
 Frame = +2

Query: 98  DVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLP 268
           ++   G +VV    L + +D P+ +L   W+     +SDM+L+  IS ++  + Y+P
Sbjct: 215 EIVPGGRMVVSL--LVKRSDKPDTELIQPWTPAVTALSDMALRGVISKEKLDSFYIP 269


>07_03_1503 + 27017933-27018063,27019668-27019727,27019996-27020101,
            27020254-27020325,27021008-27021061,27021707-27021856,
            27022206-27022547,27022651-27024684,27024706-27024947,
            27025658-27026235,27026329-27028183,27028533-27028851,
            27028980-27029417
          Length = 2126

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 12/37 (32%), Positives = 22/37 (59%)
 Frame = +2

Query: 323  VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTG 433
            +  L    ++HG  N ++++AV  +K   +I+HLL G
Sbjct: 1328 ISALVVGSVIHGVVNIERMVAVLKIKDGLDILHLLRG 1364


>05_05_0116 -
           22496535-22496576,22496974-22497058,22497468-22497545,
           22497656-22497803,22498612-22498771,22499056-22499058
          Length = 171

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 9/27 (33%), Positives = 19/27 (70%)
 Frame = -2

Query: 253 VLLFNGNVVLQRHIRDLHIVATPSAEK 173
           +++F+G++V+ + I+DLH   T   E+
Sbjct: 57  IVMFDGHIVVYKFIQDLHFFVTGGEEE 83


>04_04_1155 -
           31308704-31309051,31309301-31309451,31309532-31309763,
           31309854-31310064,31310304-31310422,31310507-31310581,
           31310789-31310990,31311075-31311454,31311569-31311633,
           31311735-31311779,31312166-31312231,31312667-31312741,
           31313022-31313093,31313659-31313727,31313813-31313884,
           31313995-31314066,31314441-31314512,31314597-31314668,
           31315091-31315162,31315279-31315474,31316094-31316202
          Length = 924

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = -1

Query: 386 RPSVFCHCSDRASLESL*GAPRLGTGLYGNACVHTCQLNEVNIL 255
           RP+VF +   R++ E+   + RLG G YG   V+  +LN+  ++
Sbjct: 579 RPNVFSYSELRSATENFSSSNRLGEGGYG--AVYKGKLNDGRVV 620


>01_07_0219 +
           42079095-42079399,42079584-42079728,42081695-42081739,
           42082150-42082265,42082913-42083012,42083103-42083138,
           42083301-42083351,42083431-42083565
          Length = 310

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 17/40 (42%), Positives = 21/40 (52%)
 Frame = +2

Query: 521 RRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVA 640
           RR+AV  + +RR+  A WL   GAR A  R     A C A
Sbjct: 9   RREAVRAAHVRRIEAAAWL---GARRAT-RREDAAARCAA 44


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,821,533
Number of Sequences: 37544
Number of extensions: 372770
Number of successful extensions: 922
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 903
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 919
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1632177336
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -