SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B03
         (549 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_08_0310 - 16669565-16669822,16670558-16670794                      145   2e-35
03_01_0290 + 2246791-2247027,2248089-2248346                          145   2e-35
04_04_0823 + 28383798-28383864,28384475-28384877,28387388-283879...    31   0.46 
04_01_0589 + 7704262-7704429,7704718-7705540,7705844-7706484           30   1.1  
09_06_0235 - 21763470-21764511,21767865-21768261,21768625-217686...    30   1.4  
03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510...    30   1.4  
02_04_0007 - 18858587-18859529,18860434-18860830,18861674-18861812     30   1.4  
01_01_0136 + 1237623-1237820,1238313-1239001,1239978-1240308,124...    30   1.4  
01_06_1794 - 39919363-39920025                                         29   1.8  
09_01_0142 - 2103224-2103864,2104264-2104399                           29   2.4  
08_01_0283 - 2304024-2304111,2304224-2304343,2304594-2304715,230...    29   2.4  
01_01_0167 + 1422344-1424260,1424338-1424472,1424568-1424990,142...    29   3.2  
09_02_0307 + 7131031-7131326,7131414-7131560,7132579-7132711,713...    28   4.3  
05_03_0549 - 15349259-15349346,15349466-15349585,15349899-153500...    28   4.3  
03_05_0435 - 24259864-24260206,24260302-24260467,24261175-242612...    28   4.3  
03_02_0263 - 6948618-6948818,6948909-6948971,6949078-6949146,694...    28   4.3  
02_01_0391 + 2838471-2838794,2838892-2839028,2841155-2841631,284...    28   4.3  
01_01_0990 + 7847066-7847478,7847713-7848679                           28   4.3  
03_06_0467 + 34145126-34145187,34145403-34145759,34146161-341462...    28   5.6  
02_05_0026 + 25168944-25168991,25169114-25169179,25169414-25169599     28   5.6  
01_06_0304 + 28340976-28342512,28342774-28342799,28343268-28343999     28   5.6  
01_01_0667 + 5099026-5099188,5099262-5099661,5099748-5100648           28   5.6  
07_01_0174 - 1227871-1228043,1228303-1228423,1228519-1228588,122...    27   7.5  
03_06_0486 - 34261577-34261692,34261830-34262094,34263164-342632...    27   7.5  
03_06_0140 + 31951569-31951710,31951943-31952037,31952141-319539...    27   7.5  
10_05_0007 + 7759814-7760063,7760367-7760507,7760580-7761007           27   9.9  
09_02_0487 + 9828283-9829354,9830436-9830580,9830863-9831153,983...    27   9.9  
08_02_0830 - 21617485-21618198                                         27   9.9  
08_01_0219 + 1749648-1750000,1750548-1750557                           27   9.9  
06_03_0846 - 25328224-25330613,25330716-25330794                       27   9.9  

>10_08_0310 - 16669565-16669822,16670558-16670794
          Length = 164

 Score =  145 bits (352), Expect = 2e-35
 Identities = 66/129 (51%), Positives = 93/129 (72%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y++ YK+G+ VD++ NGAV KGMPHK YHG+TGRV+NVT  A+GV +NK+V  RII KRI
Sbjct: 30  YLRTYKIGEHVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIRKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           ++RVEHV+ S+C ++F  R  +N++L  +AKA G+ ++ KRQP  PK   +V G      
Sbjct: 90  HVRVEHVQPSRCTEEFRLRKIKNDQLKADAKARGEVISTKRQPQGPKPGFMVEGATLET- 148

Query: 485 LAPIPYEFV 511
           + PIPY+ V
Sbjct: 149 VTPIPYDVV 157


>03_01_0290 + 2246791-2247027,2248089-2248346
          Length = 164

 Score =  145 bits (352), Expect = 2e-35
 Identities = 66/129 (51%), Positives = 92/129 (71%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y++ YK+GD VD++ NGAV KGMPHK YHG+TGRV+NVT  A+GV +NK+V  RII KRI
Sbjct: 30  YLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIRKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           ++RVEHV+ S+C ++   R  +N++L  +AKA G+ ++ KRQP  PK   +V G      
Sbjct: 90  HVRVEHVQPSRCTEELRLRKIKNDQLKADAKARGEVISTKRQPEGPKPGFMVEGATLET- 148

Query: 485 LAPIPYEFV 511
           + PIPY+ V
Sbjct: 149 VTPIPYDVV 157


>04_04_0823 +
           28383798-28383864,28384475-28384877,28387388-28387932,
           28387978-28388594
          Length = 543

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 26/69 (37%), Positives = 34/69 (49%), Gaps = 5/69 (7%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC*ACQ 327
           +++W C   SK YA QS  WK  S++   C     RCDC    SR+D    H+  C A  
Sbjct: 117 EKKWKCDKCSKRYAVQS-DWKAHSKI---CGTREYRCDCGTLFSRRDSFITHRAFCDA-- 170

Query: 328 ALQVQTRLP 354
             Q  +RLP
Sbjct: 171 LAQESSRLP 179


>04_01_0589 + 7704262-7704429,7704718-7705540,7705844-7706484
          Length = 543

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 1/94 (1%)
 Frame = +2

Query: 218 TGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAK 397
           T R  NV      +IV   VRGRI+P  I   ++H +         K+ +EN   L+  +
Sbjct: 409 TNRHLNVQPPPQRIIVKGTVRGRIVPPAIVSSLQHQRQQG------KQCQENNSSLQLQR 462

Query: 398 AAGKTVNLKRQPAP-PKAAHIVSGTEKPVLLAPI 496
                    +Q +P P  + IVS +  P  +API
Sbjct: 463 GGTLLRQHPQQVSPAPGRSTIVSSSNAP-RIAPI 495


>09_06_0235 -
           21763470-21764511,21767865-21768261,21768625-21768632,
           21769489-21769565
          Length = 507

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 27/75 (36%), Positives = 35/75 (46%), Gaps = 7/75 (9%)
 Frame = +1

Query: 151 HCRH--QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQY 309
           +CR   +++W C   SK YA QS  WK  S+    C     RCDC    SR+D    H+ 
Sbjct: 115 YCRKHGEKKWRCDKCSKRYAVQS-DWKAHSKT---CGTREYRCDCGTLFSRRDSFITHRA 170

Query: 310 PC*ACQALQVQTRLP 354
            C A    Q   R+P
Sbjct: 171 FCDA--LAQENARMP 183


>03_02_0027 +
           5100865-5100878,5102241-5102708,5102795-5103021,
           5103670-5104577
          Length = 538

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 25/89 (28%), Positives = 36/89 (40%), Gaps = 3/89 (3%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCSRCDCQQACSRKDYTEAHQYPC*ACQAL 333
           +++W C   SK YA QS  WK  ++        RCDC    SR+D    H+  C A    
Sbjct: 121 EKKWKCDKCSKKYAVQS-DWKAHTKTCGSREY-RCDCGTLFSRRDSFITHRAFCDALAEE 178

Query: 334 QVQTRLP*ESQRE*EATEGSQGCRQDRQP 420
             + R       + + T  S G    + P
Sbjct: 179 SAKARAAPPPPADEDGTSASAGAPPPQAP 207


>02_04_0007 - 18858587-18859529,18860434-18860830,18861674-18861812
          Length = 492

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA QS  WK  +++   C     RCDC    SRKD    H+  C
Sbjct: 139 EKKWKCDRCSKKYAVQS-DWKAHTKI---CGTKEYRCDCGTIFSRKDSFITHRAFC 190


>01_01_0136 +
           1237623-1237820,1238313-1239001,1239978-1240308,
           1240614-1241351
          Length = 651

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = -1

Query: 153 MSPTLYTFMXRGERNSSMCAEPASEQVPWCR 61
           ++P LY  M RG    S C     ++  WCR
Sbjct: 60  LTPPLYQCMRRGHITCSTCVAEMGQECQWCR 90


>01_06_1794 - 39919363-39920025
          Length = 220

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 15/46 (32%), Positives = 21/46 (45%)
 Frame = +2

Query: 359 RVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLAPI 496
           R ++ ++   EA AAG   + KRQP PP      SG       A +
Sbjct: 27  RQQQQQQQQYEAAAAGDKTSAKRQPPPPSRLKKTSGRNDDAATAAV 72


>09_01_0142 - 2103224-2103864,2104264-2104399
          Length = 258

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 1/94 (1%)
 Frame = +2

Query: 218 TGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAK 397
           T R  NV      +IV   VRGRI+P  I   ++H +         K+ +EN   L+  +
Sbjct: 124 TNRHLNVQPPPQRIIVKGTVRGRIVPPAIVSSLQHQRQQG------KQCQENNSSLQLQR 177

Query: 398 AAGKTVNLKRQPAP-PKAAHIVSGTEKPVLLAPI 496
            +       +Q +P P    +VS +  P  +API
Sbjct: 178 GSMLLRQHPQQVSPAPGRPTVVSSSNAP-RIAPI 210


>08_01_0283 -
           2304024-2304111,2304224-2304343,2304594-2304715,
           2304824-2305096,2305454-2305558,2305635-2305851,
           2306012-2306262,2306518-2306724,2307087-2307351,
           2308655-2308749
          Length = 580

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +1

Query: 145 WRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCS 246
           W    H  QW     YAT+ I W+ R+ V  D S
Sbjct: 535 WISIGHSTQWLWYSVYATKQISWRTRALVISDWS 568


>01_01_0167 +
           1422344-1424260,1424338-1424472,1424568-1424990,
           1425183-1425252,1425356-1425495,1425620-1425679,
           1425776-1425931,1426272-1426541
          Length = 1056

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +2

Query: 137 YKVGDIVDIRGNGAVQKGMPHKVY 208
           ++ GDI+ I G+G+V K  PH++Y
Sbjct: 623 FEDGDIIVIWGDGSVSKVGPHEIY 646


>09_02_0307 +
           7131031-7131326,7131414-7131560,7132579-7132711,
           7133115-7133207,7133421-7133717
          Length = 321

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = +2

Query: 386 KEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLAPIPYEFVA 514
           ++A AA +   L+      + A    G E+P  L P+PYE+ A
Sbjct: 77  RKAAAAAEADALRSAARQARTASSWYGDERPRWLGPVPYEYPA 119


>05_03_0549 -
           15349259-15349346,15349466-15349585,15349899-15350020,
           15350511-15350783,15351398-15351502,15351588-15351804,
           15352031-15352281,15352582-15352776,15352881-15353139,
           15354617-15354714
          Length = 575

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 11/32 (34%), Positives = 14/32 (43%)
 Frame = +1

Query: 145 WRHCRHQRQWCSSKGYATQSIPWKDRSRVQRD 240
           W H  H  QW     YA++   W+ R  V  D
Sbjct: 530 WIHVGHSTQWLWYSVYASKQFSWRTRMLVVSD 561


>03_05_0435 -
           24259864-24260206,24260302-24260467,24261175-24261241,
           24261553-24261648,24261718-24261898,24262252-24262323,
           24262393-24262505,24262596-24262817,24263262-24263910,
           24264118-24264206,24265932-24266015,24266219-24266358,
           24266522-24266573
          Length = 757

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +1

Query: 178 SSKGYATQSIPWKDRSRVQRDC--SCSRCDCQQACSRKDYTE 297
           +S G + Q  P + R + Q D   SC RC C+++   K Y E
Sbjct: 436 TSAGNSGQENPKRKRQKCQNDNVDSCKRCSCKKSKCLKLYCE 477


>03_02_0263 -
           6948618-6948818,6948909-6948971,6949078-6949146,
           6949232-6949297,6949380-6949526,6949608-6949702,
           6949845-6950016,6952187-6952318,6953581-6953674,
           6954067-6954184,6955884-6957057
          Length = 776

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 11/28 (39%), Positives = 13/28 (46%)
 Frame = +1

Query: 232 QRDCSCSRCDCQQACSRKDYTEAHQYPC 315
           Q  C C  C C  +  RKD   A +Y C
Sbjct: 391 QDTCGCMMCKCIYSDQRKDIVLADKYTC 418


>02_01_0391 +
           2838471-2838794,2838892-2839028,2841155-2841631,
           2841719-2841999,2843009-2843051,2844094-2844148,
           2845771-2845824,2846282-2846314,2846574-2846621,
           2846885-2846950,2847286-2847426
          Length = 552

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = -3

Query: 334 GVLDMLNTDIDAL-RYNPSANTLVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDV 158
           GV+++  ++ +A  RYN +A+ L +  TES+ S  +   C++    +   + + T     
Sbjct: 239 GVIEIPYSEEEACCRYNETASILKELITESVGSEAIGVDCIADFRRLLRQMESMTSVCQE 298

Query: 157 YNVSN 143
           Y +SN
Sbjct: 299 YIISN 303


>01_01_0990 + 7847066-7847478,7847713-7848679
          Length = 459

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA QS  WK  S+    C     RCDC    SR+D    H+  C
Sbjct: 98  EKKWKCDKCSKRYAVQS-DWKAHSKT---CGTREYRCDCGTLFSRRDSFITHRAFC 149


>03_06_0467 +
           34145126-34145187,34145403-34145759,34146161-34146248,
           34146361-34146506,34146892-34146936,34147030-34147133,
           34147225-34147361,34147651-34147761,34148455-34148664
          Length = 419

 Score = 27.9 bits (59), Expect = 5.6
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = +3

Query: 393 PRLPARPST*RDSQLPLKLPTSSVELRNPSYLRLSH 500
           P L  RP   R    P+  PT + +++ PS+L L H
Sbjct: 347 PNLQERPMDRRPELGPMPFPTQAWQMQAPSHLPLLH 382


>02_05_0026 + 25168944-25168991,25169114-25169179,25169414-25169599
          Length = 99

 Score = 27.9 bits (59), Expect = 5.6
 Identities = 13/36 (36%), Positives = 24/36 (66%)
 Frame = +2

Query: 323 VKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQ 430
           ++ +KCRQD++  VK++ +L+++  A  K    KRQ
Sbjct: 1   MRQAKCRQDYMAIVKQSRQLIEKLDA--KNEPKKRQ 34


>01_06_0304 + 28340976-28342512,28342774-28342799,28343268-28343999
          Length = 764

 Score = 27.9 bits (59), Expect = 5.6
 Identities = 11/32 (34%), Positives = 15/32 (46%)
 Frame = +1

Query: 214 KDRSRVQRDCSCSRCDCQQACSRKDYTEAHQY 309
           K    ++  CSCS+ D   +CS  D   A  Y
Sbjct: 270 KGHLSIEEPCSCSKDDTDSSCSLADEHHARHY 301


>01_01_0667 + 5099026-5099188,5099262-5099661,5099748-5100648
          Length = 487

 Score = 27.9 bits (59), Expect = 5.6
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA  S  WK  S+V   C     RCDC    SR+D    H+  C
Sbjct: 148 EKKWKCDKCSKRYAVHS-DWKAHSKV---CGTREYRCDCGTLFSRRDSFITHRAFC 199


>07_01_0174 -
           1227871-1228043,1228303-1228423,1228519-1228588,
           1228877-1228953,1229215-1229393,1229558-1229684,
           1229849-1229861,1230351-1230378,1230426-1230516,
           1230870-1230956,1231239-1231276,1231426-1231464,
           1231553-1231699,1231899-1231958,1232033-1232111,
           1232429-1232517,1232906-1232967,1233238-1233427,
           1233929-1234068,1235813-1236147,1237086-1237133
          Length = 730

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +2

Query: 188 GMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKC 340
           G P     G T  VY+V AH+ GVIV+          +  I V+ ++H  C
Sbjct: 137 GQPLLEMIGHTSLVYSVDAHSSGVIVSGSEDRSAKIWKDGICVQSIEHPGC 187


>03_06_0486 -
           34261577-34261692,34261830-34262094,34263164-34263277,
           34263371-34264795
          Length = 639

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 15/56 (26%), Positives = 23/56 (41%)
 Frame = +1

Query: 103 GTIPLSTXHESVQSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQ 270
           G+ P +T  ++   W   R  R+    +G       WK     +RDCS  +   QQ
Sbjct: 307 GSAPSTTASDNQDQWGRRRRTRRSRPPRGADDDQRRWKCEWEQERDCSNLKPPTQQ 362


>03_06_0140 +
           31951569-31951710,31951943-31952037,31952141-31953982,
           31954065-31954179,31954260-31954897
          Length = 943

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 288 LYRSASISVLSMSSTPSADKTSLRESKRM 374
           +Y+SA++ V + SS P+ADK + +  ++M
Sbjct: 410 VYKSANLQVSNSSSIPAADKQTRQTMRQM 438


>10_05_0007 + 7759814-7760063,7760367-7760507,7760580-7761007
          Length = 272

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 2/46 (4%)
 Frame = +2

Query: 218 TGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKH--SKCRQD 349
           T R  NV      +IV   VRGRI+P  I   ++H +    +C+++
Sbjct: 138 TNRHLNVQPPPQRIIVKGTVRGRIVPPAIVSSLQHQRQQGKQCQEN 183


>09_02_0487 +
           9828283-9829354,9830436-9830580,9830863-9831153,
           9831984-9832032
          Length = 518

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = +2

Query: 362 VKENERLLKEAKAA--GKTVNLKRQPAPPKAAH-IVSGTEKPVLLAP 493
           V+ +++ LK  +A   G   N  R P PP+A++ I  G   P+LL+P
Sbjct: 93  VQPSKKFLKSLEACIPGNCTN-GRLPTPPQASNDIEEGANMPLLLSP 138


>08_02_0830 - 21617485-21618198
          Length = 237

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = +2

Query: 332 SKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAA 451
           S CR D ++R   N+R L  A +A +  ++ ++P P K A
Sbjct: 149 SPCRADSVERWDSNKRPLSRASSAERW-DINKKPRPKKDA 187


>08_01_0219 + 1749648-1750000,1750548-1750557
          Length = 120

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = -2

Query: 122 VESGIVPCVRNLRANKXPGAAAVTLGVRHLRAL 24
           V++ ++PCV  L       +     GVRHLR L
Sbjct: 34  VDASLLPCVAYLTGKAAAPSGDCCAGVRHLRTL 66


>06_03_0846 - 25328224-25330613,25330716-25330794
          Length = 822

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 11/34 (32%), Positives = 22/34 (64%)
 Frame = +2

Query: 215 KTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRV 316
           +TG  ++V A+   V+  +R  GR++  R+N+R+
Sbjct: 158 RTGE-FDVRANVYAVVAKRRDGGRLVLPRLNLRI 190


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,105,539
Number of Sequences: 37544
Number of extensions: 315667
Number of successful extensions: 1145
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 1121
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1145
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1233951264
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -