SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B02
         (347 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0486 + 19577507-19577568,19578119-19578218,19581128-195812...    59   1e-09
11_06_0483 + 24118047-24118108,24118952-24119051,24119330-24119338     58   1e-09
03_06_0123 - 31821915-31822094,31822187-31822324,31822413-318228...    58   1e-09
03_05_0487 + 24838620-24838967,24840526-24840747,24840819-248411...    28   1.8  
07_01_0677 + 5087584-5087589,5088890-5089172,5093561-5093704,509...    27   5.3  
09_04_0627 - 19061106-19061474,19062067-19062909,19063395-190635...    26   7.1  

>12_02_0486 +
           19577507-19577568,19578119-19578218,19581128-19581214,
           19581852-19581914
          Length = 103

 Score = 58.8 bits (136), Expect = 1e-09
 Identities = 25/35 (71%), Positives = 26/35 (74%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKL 247
           CR C N HGLIRKYGL  CRQCFR  A DIGF K+
Sbjct: 21  CRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIKV 55



 Score = 38.7 bits (86), Expect = 0.001
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH+N+W SHP+ YG GSR
Sbjct: 1   MGHSNVWNSHPKNYGPGSR 19


>11_06_0483 + 24118047-24118108,24118952-24119051,24119330-24119338
          Length = 56

 Score = 58.4 bits (135), Expect = 1e-09
 Identities = 25/34 (73%), Positives = 25/34 (73%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C N HGLIRKYGL  CRQCFR  A DIGF K
Sbjct: 21  CRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIK 54



 Score = 38.7 bits (86), Expect = 0.001
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH+N+W SHP+ YG GSR
Sbjct: 1   MGHSNVWNSHPKNYGPGSR 19


>03_06_0123 -
           31821915-31822094,31822187-31822324,31822413-31822817,
           31822897-31823212,31823305-31823543,31823800-31823903,
           31823987-31824145,31824326-31824510,31825318-31825427,
           31826900-31826947,31827047-31827241,31827354-31827422,
           31829521-31829620,31829879-31829940
          Length = 769

 Score = 58.4 bits (135), Expect = 1e-09
 Identities = 25/34 (73%), Positives = 25/34 (73%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C N HGLIRKYGL  CRQCFR  A DIGF K
Sbjct: 21  CRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIK 54



 Score = 38.7 bits (86), Expect = 0.001
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH+N+W SHP+ YG GSR
Sbjct: 1   MGHSNVWNSHPKNYGPGSR 19


>03_05_0487 + 24838620-24838967,24840526-24840747,24840819-24841109,
            24841316-24841513,24841641-24841705,24841788-24841874,
            24841988-24842108,24842200-24842244,24842321-24842458,
            24842571-24842643,24842723-24842799,24842882-24842989,
            24843108-24843224,24843524-24843679,24843780-24843881,
            24844036-24844161,24844237-24844314,24844390-24844485,
            24844592-24844707,24844781-24844850,24844930-24844983,
            24845062-24845205,24845297-24845596,24845780-24846202,
            24846316-24846429
          Length = 1222

 Score = 28.3 bits (60), Expect = 1.8
 Identities = 10/39 (25%), Positives = 22/39 (56%)
 Frame = +2

Query: 101  GILTLADTDKDLGSCRSCSNRHGLIRKYGLNICRQCFRE 217
            G++ +A+  K+   CR C N+  +++ +    C+  F+E
Sbjct: 1160 GLIAIANLKKNSFECRGCKNKTDIVQVHIPYACKLLFQE 1198


>07_01_0677 +
           5087584-5087589,5088890-5089172,5093561-5093704,
           5094167-5095269
          Length = 511

 Score = 26.6 bits (56), Expect = 5.3
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 177 RIKPCLLEQDRHXPRSL 127
           R+ PCLL +D H  RSL
Sbjct: 292 RVNPCLLNRDGHTARSL 308


>09_04_0627 -
           19061106-19061474,19062067-19062909,19063395-19063501,
           19064301-19064332,19064384-19064663,19065092-19065475,
           19066730-19066803,19067244-19067310,19067415-19067486,
           19067941-19068000,19068683-19068734,19068874-19068943,
           19069110-19069372
          Length = 890

 Score = 26.2 bits (55), Expect = 7.1
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = -1

Query: 197 ICSNRTCGLSHACWSRIGMXRD 132
           I   +T GL H  + R+GM RD
Sbjct: 523 ILRKKTMGLEHKAYRRVGMARD 544


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,989,016
Number of Sequences: 37544
Number of extensions: 127135
Number of successful extensions: 241
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 237
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 241
length of database: 14,793,348
effective HSP length: 73
effective length of database: 12,052,636
effective search space used: 506210712
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -