SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A24
         (653 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_01_0348 - 2607315-2607424,2608634-2609030                          103   1e-22
06_01_0428 + 3055163-3055573                                          103   1e-22
06_01_0427 - 3054204-3054614                                          103   1e-22
06_01_0425 - 3045557-3046004,3046852-3046856                          103   1e-22
06_01_0423 - 3039527-3039937                                          103   1e-22
05_04_0449 - 21355439-21355849                                        103   1e-22
04_03_0909 + 20748653-20749063                                        103   1e-22
01_06_1456 + 37507156-37507566                                        103   1e-22
06_01_0217 - 1644696-1645034,1645143-1645214                          100   9e-22
03_03_0212 + 15479850-15479921,15479965-15480083,15480175-154802...   100   9e-22
02_03_0107 - 15303890-15304060,15304158-15304248,15304505-153046...    93   2e-19
02_03_0108 - 15324922-15325092,15325189-15325279,15325511-15325596     92   4e-19
04_04_0062 + 22437653-22437724,22437866-22437943,22438222-22438392     91   9e-19
12_02_0048 - 12852335-12852745                                         88   7e-18
12_02_0047 - 12836779-12837189                                         83   2e-16
05_05_0297 - 23921648-23921758,23922011-23922089,23922774-239228...    58   8e-09
02_01_0611 - 4567839-4568144,4568280-4569209,4569301-4569566,456...    30   1.4  
09_04_0353 + 16915618-16916934                                         29   2.4  
04_04_1457 - 33741048-33741146,33741647-33741760,33741938-337420...    29   3.2  
02_05_0729 - 31271566-31271730,31271799-31271933,31272210-312722...    29   4.3  
11_01_0128 - 1043053-1043151,1043238-1043570,1043588-1043707,104...    28   5.6  
02_02_0321 - 8934512-8935504,8935581-8935715,8935831-8936217           28   5.6  
03_06_0244 + 32613914-32614666                                         28   7.5  

>11_01_0348 - 2607315-2607424,2608634-2609030
          Length = 168

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRG
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 133


>06_01_0428 + 3055163-3055573
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>06_01_0427 - 3054204-3054614
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>06_01_0425 - 3045557-3046004,3046852-3046856
          Length = 150

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 60  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 118



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 117 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 150



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 24/28 (85%), Positives = 26/28 (92%)
 Frame = +3

Query: 174 RKQLATKAARKSAPSTGGVKKPHRYRPG 257
           RKQLATKA  KSAP+TGGVKKPHR+RPG
Sbjct: 32  RKQLATKATCKSAPATGGVKKPHRFRPG 59


>06_01_0423 - 3039527-3039937
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>05_04_0449 - 21355439-21355849
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>04_03_0909 + 20748653-20749063
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>01_06_1456 + 37507156-37507566
          Length = 136

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>06_01_0217 - 1644696-1645034,1645143-1645214
          Length = 136

 Score =  100 bits (240), Expect = 9e-22
 Identities = 51/59 (86%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGL 104



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>03_03_0212 +
           15479850-15479921,15479965-15480083,15480175-15480265,
           15480363-15480533
          Length = 150

 Score =  100 bits (240), Expect = 9e-22
 Identities = 51/59 (86%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQS A+ ALQEA+EAYL  L
Sbjct: 60  TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGL 118



 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 44/59 (74%), Positives = 45/59 (76%), Gaps = 14/59 (23%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATK--------------AARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATK              AARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKSDFDRWSYITISVQAARKSAPTTGGVKKPHRYRPG 59



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 117 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 150


>02_03_0107 -
           15303890-15304060,15304158-15304248,15304505-15304614,
           15304715-15304784,15306365-15306558
          Length = 211

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 47/59 (79%), Positives = 52/59 (88%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQK+TELLIRKLPFQRLVREIAQ FK D+ FQS A+ ALQEA+EAYL  L
Sbjct: 121 TVALREIRKYQKNTELLIRKLPFQRLVREIAQHFKHDMRFQSHAVLALQEAAEAYLVGL 179



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 30/33 (90%), Positives = 32/33 (96%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           GLFEDTNLCAIH+KRVTIM KD+QLARRIRGER
Sbjct: 178 GLFEDTNLCAIHSKRVTIMSKDVQLARRIRGER 210



 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 34/55 (61%), Positives = 36/55 (65%), Gaps = 10/55 (18%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTG----------GVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRK L   AA   APS+           GVKKP R+RPG
Sbjct: 66  MARTKQTARKSTGGKAPRKPLRAIAAVMPAPSSRGVARKSVPFIGVKKPRRHRPG 120


>02_03_0108 - 15324922-15325092,15325189-15325279,15325511-15325596
          Length = 115

 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 47/59 (79%), Positives = 52/59 (88%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+YQK+TELLIRKLPFQRLVREIAQ FK D+ FQS A+ ALQEA+EAYL  L
Sbjct: 25  TVALREIRKYQKNTELLIRKLPFQRLVREIAQLFKHDMRFQSHAVLALQEAAEAYLVGL 83



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 30/33 (90%), Positives = 32/33 (96%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           GLFEDTNLCAIH+KRVTIM KD+QLARRIRGER
Sbjct: 82  GLFEDTNLCAIHSKRVTIMSKDVQLARRIRGER 114



 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 19/21 (90%), Positives = 19/21 (90%)
 Frame = +3

Query: 195 AARKSAPSTGGVKKPHRYRPG 257
           AARKSAP  GGVKKPHRYRPG
Sbjct: 4   AARKSAPCIGGVKKPHRYRPG 24


>04_04_0062 + 22437653-22437724,22437866-22437943,22438222-22438392
          Length = 106

 Score = 90.6 bits (215), Expect = 9e-19
 Identities = 42/44 (95%), Positives = 43/44 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP 254
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRY P
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYPP 44



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 73  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 106



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +1

Query: 364 TDLXFQSAAIGALQEASEAYLXWL 435
           TDL FQS A+ ALQEA+EAYL  L
Sbjct: 51  TDLRFQSHAVLALQEAAEAYLVGL 74


>12_02_0048 - 12852335-12852745
          Length = 136

 Score = 87.8 bits (208), Expect = 7e-18
 Identities = 44/61 (72%), Positives = 52/61 (85%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           TVALREIR YQKSTELLIRKLPFQRLV+EIAQD ++ + FQS+A+ ALQEA+E YL  L 
Sbjct: 46  TVALREIRTYQKSTELLIRKLPFQRLVQEIAQDVRSYVRFQSSAVVALQEAAETYLVGLF 105

Query: 439 R 441
           +
Sbjct: 106 K 106



 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 31/34 (91%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLF+DTNLC IHAKRVTIMPKDIQLARRIRGE+A
Sbjct: 103 GLFKDTNLCVIHAKRVTIMPKDIQLARRIRGEKA 136



 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 30/45 (66%), Positives = 35/45 (77%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTA+KST    PRK L  K ARKSAP+  G+KKPHR++PG
Sbjct: 1   MARTKQTAKKSTASNVPRKLLVMKVARKSAPTMAGLKKPHRFKPG 45


>12_02_0047 - 12836779-12837189
          Length = 136

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 41/58 (70%), Positives = 48/58 (82%)
 Frame = +1

Query: 262 VALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           VALREIR YQKSTELLIRKLPFQRLV+EI QD ++ + FQS+A+  LQEA+E YL  L
Sbjct: 47  VALREIRTYQKSTELLIRKLPFQRLVQEITQDIRSYVRFQSSAMAVLQEAAETYLVGL 104



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 30/44 (68%), Positives = 33/44 (75%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP 254
           MARTKQTA+KST G  PRK L  K ARKSAP   G+KKPHR+ P
Sbjct: 1   MARTKQTAKKSTAGNVPRKLLVMKVARKSAPMMAGLKKPHRFNP 44



 Score = 64.9 bits (151), Expect = 5e-11
 Identities = 30/34 (88%), Positives = 31/34 (91%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLC IHAKRVTIMPKDIQLAR I GE+A
Sbjct: 103 GLFEDTNLCVIHAKRVTIMPKDIQLARCIGGEKA 136


>05_05_0297 -
           23921648-23921758,23922011-23922089,23922774-23922822,
           23923180-23923255,23923693-23923767,23923862-23923992,
           23924830-23924935
          Length = 208

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 1/57 (1%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL-XFQSAAIGALQEASEAYL 426
           TVALREIR++QK+TELLI   PF RLVREI   +  D+  +   A+ ALQEA+E +L
Sbjct: 54  TVALREIRKFQKTTELLIPFAPFSRLVREITDFYSKDVSRWTLEALLALQEAAEYHL 110



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 25/32 (78%), Positives = 28/32 (87%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           +FE +NLCAIHAKRVTIM KD+QLARRI G R
Sbjct: 113 IFEVSNLCAIHAKRVTIMQKDMQLARRIGGRR 144



 Score = 29.1 bits (62), Expect = 3.2
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 8/53 (15%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKS-APSTGGV-------KKPHRYRPG 257
           MARTK  A + +  +  +K    ++ R S A   GG        +KPHR+RPG
Sbjct: 1   MARTKHPAVRKSKAEPKKKLQFERSPRPSKAQRAGGTPRQQTKQRKPHRFRPG 53


>02_01_0611 -
           4567839-4568144,4568280-4569209,4569301-4569566,
           4569662-4569970,4570497-4570647,4570958-4571012,
           4571137-4571512,4571560-4571797,4571878-4572096,
           4572629-4572910
          Length = 1043

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = +3

Query: 126 ARTKQTARKS-TGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP 254
           AR    AR+   GG+ P + LA+ A   SA + GG ++P  + P
Sbjct: 14  ARAAAAARRHHAGGRDPLRALASLAGDASASAGGGARRPAWFAP 57


>09_04_0353 + 16915618-16916934
          Length = 438

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = -2

Query: 526 FTTDSSSKLNILRHDGHTFGVNSTQVGV 443
           F  DS+S   +L ++  TFG NST+V V
Sbjct: 163 FYGDSASSAGVLANETFTFGTNSTRVAV 190


>04_04_1457 - 33741048-33741146,33741647-33741760,33741938-33742052,
            33742154-33742560,33743342-33743476,33743576-33743970,
            33744225-33744916,33745014-33745097,33745195-33745286,
            33745374-33745457,33745535-33745714,33746258-33746302,
            33746399-33746692,33747199-33747585,33747713-33747899,
            33748042-33748118,33748936-33749067,33749315-33749416,
            33749744-33749827,33749902-33749992,33750105-33750178,
            33750644-33750664,33751433-33751477,33752427-33752561,
            33752693-33752752
          Length = 1376

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = +1

Query: 79   KISSLTCEKH*KSKQWLVLNKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHI 243
            K+  +  E H + KQ +V N LP  L        NL+++RR+ QR    E  S I
Sbjct: 1303 KLIKVVYEHHPRPKQLIVENDLPQKL-------QNLIEERRDGQRGGQQEKNSFI 1350


>02_05_0729 -
           31271566-31271730,31271799-31271933,31272210-31272284,
           31273003-31273068,31273154-31273222,31273303-31273377,
           31273518-31273628,31273947-31274009,31274064-31274453
          Length = 382

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = -2

Query: 532 STFTTDSSSKLNILRHDGHTFGVNSTQVGVFEQAXRDKPRLP-PGELRWR 386
           S+F  D +  L+++R+D    G+N  Q  + +   R  P L   G++ W+
Sbjct: 333 SSFIQDQTRALDMIRNDPELMGLNLIQAPLVDMEIRGVPALKFLGDIVWK 382


>11_01_0128 -
           1043053-1043151,1043238-1043570,1043588-1043707,
           1043810-1043993,1044088-1044275,1044714-1044808,
           1044884-1045003,1045232-1045350,1052717-1052799,
           1052892-1053071
          Length = 506

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 25/70 (35%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = -2

Query: 241 CGFLTPPVLGADFRAAFVASCLRGALPPV-DLRAVCLVRAIVYFFNVFHKLSY*FSIILE 65
           C +L PP L ADF    +A  LR  LPP  DL++  +V  IV   +  H   Y  +    
Sbjct: 328 CDYLDPP-LKADFNEQCLAEHLREVLPPAKDLQSWKMV--IVPVIHHSHWTLYCVNRNHG 384

Query: 64  FIDQFHNNDH 35
            ID F +N++
Sbjct: 385 RIDVFDSNNY 394


>02_02_0321 - 8934512-8935504,8935581-8935715,8935831-8936217
          Length = 504

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 12/49 (24%), Positives = 28/49 (57%)
 Frame = +1

Query: 79  KISSLTCEKH*KSKQWLVLNKLPVNLLEVKLRVNNLLQKRRENQRRALV 225
           K     C++  + +Q  ++ +  + LL+ K + +N+++K +E QR+  V
Sbjct: 354 KQEEAACQEKEEEEQKKIMKQEALQLLKKKEKTDNIIKKTKEEQRKKKV 402


>03_06_0244 + 32613914-32614666
          Length = 250

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = -1

Query: 407 SWRAPMAADWKXKSVLKS*AISLTRRWKGSLRISNSVD 294
           SW    A  WK  +V +    +  RRWK S+    S+D
Sbjct: 207 SWARHQAMQWKASAVSRLVPAAHRRRWKASVVSRRSLD 244


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,320,834
Number of Sequences: 37544
Number of extensions: 252955
Number of successful extensions: 725
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 678
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 723
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1632177336
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -