SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A23
         (527 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_04_0129 + 17520753-17520842,17521651-17521741,17521887-175220...   105   3e-23
02_01_0385 + 2783387-2783695,2784149-2785082,2785206-2785309,278...    28   4.0  
08_01_0036 - 267236-268165,268255-268299,268485-268574,269485-26...    28   5.3  
11_01_0645 + 5185341-5185568,5185773-5185823                           27   7.1  
10_08_0669 + 19742140-19742189,19742886-19742923,19744260-197444...    27   7.1  
06_03_0118 + 16836401-16837456,16837558-16837701,16837812-16838231     27   7.1  
05_01_0089 + 589457-589506,589598-589741,589820-589903,590118-59...    27   7.1  
10_08_0340 - 16934317-16934478,16934569-16934745,16934842-169349...    27   9.3  
02_02_0146 - 7171656-7172044,7172383-7175008                           27   9.3  
01_06_1208 + 35424241-35424370,35424415-35424728,35424782-354249...    27   9.3  

>03_04_0129 +
           17520753-17520842,17521651-17521741,17521887-17522070,
           17522149-17522224
          Length = 146

 Score =  105 bits (251), Expect = 3e-23
 Identities = 44/87 (50%), Positives = 64/87 (73%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y R A+I R IY+R  +GV    KI+GGR+RNG  P HFC+SSG+I+R  LQ L+ + 
Sbjct: 55  WYYTRAASIARKIYLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMG 114

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +++    GGR++T+QGRRDLD++A +V
Sbjct: 115 IIDVDPKGGRLITSQGRRDLDQVAGRV 141



 Score = 67.7 bits (158), Expect = 5e-12
 Identities = 29/46 (63%), Positives = 38/46 (82%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           TVKDV   + VK  +AHLK++GK+++PE +D+VKTARFKEL PYDP
Sbjct: 8   TVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDP 53


>02_01_0385 +
           2783387-2783695,2784149-2785082,2785206-2785309,
           2785402-2785486,2785517-2787578,2787732-2787753,
           2788157-2788327,2791473-2791517,2792558-2793874,
           2793962-2794012,2794090-2794188,2794352-2794504,
           2794554-2794571
          Length = 1789

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = -2

Query: 154 SCLYKIHVLRYLDFARFF*VS-SDSFNNLVLFNILYCDGTHL 32
           S +YK+ +LRYLD +     S S SFN+L+    L    T+L
Sbjct: 550 SSVYKLKLLRYLDASSLRISSFSKSFNHLLNLQALILSNTYL 591


>08_01_0036 -
           267236-268165,268255-268299,268485-268574,269485-269805,
           269895-270098,271532-271664,271810-271881,273106-273168,
           273252-275034,275169-275217
          Length = 1229

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = +1

Query: 181 PXIGSMCVVLPSFVIFTFAHLLE*RLSPRSLVGANVMELHLHISAGHQAVL 333
           P +G++ + LP F+       +   LSPR L+ A V EL L    GH A L
Sbjct: 160 PELGNLVLALPGFLSLVAVRSIPQELSPR-LLWAPVFEL-LADHRGHPAFL 208


>11_01_0645 + 5185341-5185568,5185773-5185823
          Length = 92

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = +3

Query: 225 IYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARK 341
           ++ +SP  +  +   + GR+R G  P    R +G IA +
Sbjct: 18  VHCKSPAALLGIESPYSGRRRVGARPRGGSRQAGQIAER 56


>10_08_0669 +
           19742140-19742189,19742886-19742923,19744260-19744448,
           19746402-19748188
          Length = 687

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = +3

Query: 303 SHFCRSSGSIARKALQSL-----EALKLVEKVQDGGRILTTQGRRDLDRIAAQVRL 455
           SH C S  S+ R+ LQS+     EA +L  + ++  R    Q + DLD +A ++ L
Sbjct: 193 SHPCFSKNSLCRELLQSVAATLAEAAELGARCREPPRAGKLQMQSDLDALAGKLDL 248


>06_03_0118 + 16836401-16837456,16837558-16837701,16837812-16838231
          Length = 539

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 3/61 (4%)
 Frame = +2

Query: 92  AHLKKTGKVKVPEHMDLVKTARFKELAPYD--PXLVLCALCCHPSSYLH-SLTCWSKDCH 262
           AHLK TG+   P+ +D       + +        +V  AL  HP  +    +TC   D H
Sbjct: 100 AHLKHTGRAPGPDELDRTGGLLLRAMDGMRDVARMVSSALAAHPGPFRSVHITCTPMDAH 159

Query: 263 Q 265
           +
Sbjct: 160 R 160


>05_01_0089 +
           589457-589506,589598-589741,589820-589903,590118-590261,
           590351-590401,590492-590641,591175-591488,592685-592815,
           593131-593451,594994-595057,595322-595443
          Length = 524

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 11/54 (20%), Positives = 27/54 (50%)
 Frame = +2

Query: 17  LPTQGKMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPY 178
           +P+  ++ ++ V D  +++  + +  H K TG  ++ E+       ++  L PY
Sbjct: 219 MPSASEVAALIVNDTSENQKGRDIIVHYKDTGPRRISENHPKFMAMQYPLLFPY 272


>10_08_0340 -
           16934317-16934478,16934569-16934745,16934842-16934940,
           16935025-16935225,16935389-16935409,16935554-16935661,
           16935749-16936130,16936693-16936912,16938673-16938827,
           16938960-16939183,16939648-16939707
          Length = 602

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 123 YLSTWIL*RQLASKSWLRMTLXWFYVRCAAILRHI 227
           Y+S W + R +   SWL M L W Y     + R++
Sbjct: 297 YVSRWYM-RMMWPLSWLSMVLTWTYGSSFTVERNV 330


>02_02_0146 - 7171656-7172044,7172383-7175008
          Length = 1004

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%)
 Frame = +2

Query: 152 ARFKELAPYDPXLVLCALCCHPSSYLHSLTC-WSKDCHQD 268
           A  + LA  D  L   +LCC   S +H  TC WS+    D
Sbjct: 586 AALQTLAYEDSFLDNPSLCCQSESGMHIRTCPWSQSMSHD 625


>01_06_1208 +
           35424241-35424370,35424415-35424728,35424782-35424967,
           35425361-35425523,35425601-35425787,35425875-35426016
          Length = 373

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = -3

Query: 393 HRPELSQQASMPPTIAKPCVQYCLMTCRN 307
           H  +  +  + P TIA+  +QYCL TC N
Sbjct: 116 HPTQDPEATNSPFTIAQLQLQYCLHTCTN 144


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,751,033
Number of Sequences: 37544
Number of extensions: 276373
Number of successful extensions: 712
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 700
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 712
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1166441080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -