SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A21
         (651 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_03_0765 + 19376949-19377156,19377637-19377833,19378259-193784...    29   2.4  
07_03_1793 + 29577510-29577597,29577855-29578177,29578286-295784...    29   3.2  
09_06_0285 + 22030414-22030440,22031562-22031745,22031826-22032088     28   5.6  
07_03_1645 + 28348897-28349100,28349263-28349334,28350113-283502...    27   9.8  
05_04_0083 + 17780665-17780764,17781070-17781124,17781193-177813...    27   9.8  
02_03_0394 + 18546089-18546323,18546784-18546986,18547598-185477...    27   9.8  
01_07_0101 + 41086735-41086809,41088634-41088721,41089727-410899...    27   9.8  

>04_03_0765 +
           19376949-19377156,19377637-19377833,19378259-19378448,
           19380263-19380654,19380689-19380802,19381159-19381593,
           19381936-19382038,19382080-19382177,19383217-19383552
          Length = 690

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRRSSRLSYHP 219
           G++EFL++ + L  LHH +L+NL      G++R     Y P
Sbjct: 149 GNKEFLVEVLMLSLLHHQNLVNLVGYCADGDQRLLVYEYMP 189


>07_03_1793 +
           29577510-29577597,29577855-29578177,29578286-29578475,
           29578571-29578962,29579148-29579405
          Length = 416

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRRSSRLSYHP 219
           G+ EFL++ + L  LHH +L+NL      G++R     Y P
Sbjct: 151 GNREFLVEVLMLSMLHHPNLVNLIGYCADGDQRLLVYEYMP 191


>09_06_0285 + 22030414-22030440,22031562-22031745,22031826-22032088
          Length = 157

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 15/32 (46%), Positives = 16/32 (50%)
 Frame = +2

Query: 425 NVKAEAGLAGRVASEDVAGNGFATAQAGGHNA 520
           N KAE G    V SE VAG G    Q G + A
Sbjct: 69  NQKAEGGAGEAVESEAVAGGGVVPEQEGENEA 100


>07_03_1645 +
           28348897-28349100,28349263-28349334,28350113-28350266,
           28350973-28351116,28351213-28351316,28351401-28351499,
           28351582-28351651,28352127-28352223,28352443-28352497,
           28353507-28353590,28353851-28353928,28354027-28354130,
           28354212-28354635,28355311-28355346
          Length = 574

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = +1

Query: 79  FNSKILVHIYSVREVNYLQ*RQNEVYSIINDINYIAGVFGASVYNLQGW*D 231
           F+ ++LV   +   +++   ++ E+Y I   +N++A V G  V+ L  W D
Sbjct: 367 FDPRLLVSPPTFHTLDFTTMKEEELYEIDIPLNFVASV-GTRVHGLACWFD 416


>05_04_0083 +
           17780665-17780764,17781070-17781124,17781193-17781313,
           17781361-17781429,17782047-17782274,17782477-17782666,
           17783303-17783694,17784380-17784427,17784816-17785400
          Length = 595

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRR 243
           G+ EFL++ + L  LHH +L+NL      G++R
Sbjct: 205 GNREFLVEVLMLSLLHHDNLVNLIGYCADGDQR 237


>02_03_0394 +
           18546089-18546323,18546784-18546986,18547598-18547787,
           18548624-18549015,18549495-18550055
          Length = 526

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRR 243
           G+ EFL++ + L  LHH +L+NL      G++R
Sbjct: 160 GNREFLVEVLMLSLLHHQNLVNLIGYCADGDQR 192


>01_07_0101 +
           41086735-41086809,41088634-41088721,41089727-41089923,
           41090077-41090266,41090469-41090860,41091390-41091965
          Length = 505

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = -2

Query: 338 GHEEFLLQQITLQYLHH-HLINLRARLQRGNRR 243
           G+ EFL++ + L  LHH +L+NL      G++R
Sbjct: 134 GNREFLVEVLMLSLLHHTNLVNLIGYCADGDQR 166


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,262,987
Number of Sequences: 37544
Number of extensions: 165169
Number of successful extensions: 438
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 431
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 438
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1620349964
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -