SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A19
         (601 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_1626 - 38734128-38734160,38734386-38734560,38734819-387348...    32   0.31 
06_01_0919 - 7090494-7091219,7091630-7091763,7091860-7091927,709...    31   0.53 
06_03_1318 - 29282562-29282566,29282727-29282810,29282913-292833...    29   2.8  
11_01_0450 - 3487464-3487844,3487883-3488268,3488883-3489033,348...    29   3.8  
02_01_0043 + 300122-300907,301447-301722,302347-302481                 27   8.7  

>01_06_1626 -
           38734128-38734160,38734386-38734560,38734819-38734878,
           38734961-38735059,38735191-38735224,38735315-38735374,
           38735596-38735696,38735949-38736014,38736695-38736825,
           38736946-38737038,38737273-38737338,38737459-38737494,
           38738308-38738382,38738475-38738792
          Length = 448

 Score = 32.3 bits (70), Expect = 0.31
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = +1

Query: 277 FPMVVQIEMETI--KHHGFNNSREGIVQF-TQLIRDLESIDGEVARLHTQIRSHYLPPVS 447
           +P+ VQIE +T+    H   NS   + +F T      E    +  RLH     HYLP   
Sbjct: 124 YPLRVQIEAQTVFGALHALQNSSRLLGEFLTHQDFLTEDFLLDQMRLHADTSRHYLPVTV 183

Query: 448 ISSSVDTSL*NSIKGKTWN 504
           I   +DT   + +    W+
Sbjct: 184 IKKVIDTMAYSKLNVLHWH 202


>06_01_0919 -
           7090494-7091219,7091630-7091763,7091860-7091927,
           7092471-7092515,7092620-7092639,7092798-7092860,
           7092946-7093115,7093216-7093252
          Length = 420

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = +2

Query: 356 SLSLFVTWRALMVRLP-VFILKSEATTCPLCPSVLLLTHLC 475
           ++  F T R+ ++ LP +F+ K + T C +C S L   + C
Sbjct: 364 TMGTFPTSRSFLLNLPLIFVCKEKDTECSICKSTLATKYRC 404


>06_03_1318 - 29282562-29282566,29282727-29282810,29282913-29283380,
            29283735-29283917,29284362-29284467,29284627-29284651,
            29284736-29284855,29284920-29284997,29285646-29285774,
            29285976-29285989,29286168-29287944,29288344-29288489,
            29288921-29291029
          Length = 1747

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 22/75 (29%), Positives = 34/75 (45%)
 Frame = +1

Query: 328  NNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHYLPPVSISSSVDTSL*NSIKGKTWNS 507
            N +  GIV  TQ    L     ++  LH+ + +  L PV  ++SV   + N    KT + 
Sbjct: 1586 NGNSSGIVDRTQSSDQLIYAGKDIQGLHSSMDASNLLPVQNANSVLFGVENGTTIKTESG 1645

Query: 508  STVNGVLRFSKLAFI 552
             + NG   F   AF+
Sbjct: 1646 YSSNGNFGFCGNAFL 1660


>11_01_0450 - 3487464-3487844,3487883-3488268,3488883-3489033,
            3489132-3491102,3492090-3492149,3492240-3492436,
            3492678-3492963
          Length = 1143

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = +1

Query: 256  LKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQFTQLIRDL-ESIDGEVARLHTQIRSHY 432
            LK  Q+V PM+V  E+E +K          + + T +++ + E ++ E   +H Q  +  
Sbjct: 878  LKGTQLVIPMIVIRELECLKKR--ERLFRMLSKATSMLQWINECMEKESWWIHVQSSTEM 935

Query: 433  LPPVSISSSVDTSL*NSIKGKTWNSSTVNGVLRFSKLAF 549
            LP      +  T+L N+ + +  ++ T N +  FS  +F
Sbjct: 936  LPVAPTPPATPTALCNNGE-REISAGTFNPIALFSPRSF 973


>02_01_0043 + 300122-300907,301447-301722,302347-302481
          Length = 398

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 17/50 (34%), Positives = 26/50 (52%)
 Frame = +1

Query: 184 IDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNN 333
           +DALE PDY  +   AK +   E+  M++IV P  +  +  T+    F N
Sbjct: 350 VDALEGPDYMVR--NAKRSMLEELEGMLEIVGPQSLG-KPRTLSRRKFEN 396


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,795,258
Number of Sequences: 37544
Number of extensions: 294610
Number of successful extensions: 750
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 729
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 750
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1435654836
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -