SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A18
         (487 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0790 - 21214282-21214369,21214455-21214564,21215478-212155...   128   3e-30
08_01_0372 + 3286861-3286939,3287220-3287299,3289041-3289150,328...   128   3e-30
09_04_0106 - 14636773-14636863,14636948-14637057,14638107-146381...   126   7e-30
03_05_0642 - 26346260-26346367,26347902-26348162,26348542-263498...    29   2.6  
01_05_0589 + 23459847-23460344,23460493-23461296                       27   6.0  
08_02_1022 + 23707993-23708528,23708620-23708706,23708807-237088...    27   8.0  
02_05_0798 - 31810579-31811516,31811646-31811666,31811715-31812225     27   8.0  

>08_02_0790 -
           21214282-21214369,21214455-21214564,21215478-21215557,
           21215659-21215737
          Length = 118

 Score =  128 bits (308), Expect = 3e-30
 Identities = 64/104 (61%), Positives = 77/104 (74%), Gaps = 2/104 (1%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRLT+R+R SY TKSNQ R+V+TPGGRLVYQY KK    P+C     K++GI   RPA
Sbjct: 1   MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA 60

Query: 211 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           E  RSRL   ++TV R YGGVL    V++RI+RAFL+EEQKIVK
Sbjct: 61  EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVK 104


>08_01_0372 +
           3286861-3286939,3287220-3287299,3289041-3289150,
           3289224-3289311
          Length = 118

 Score =  128 bits (308), Expect = 3e-30
 Identities = 64/104 (61%), Positives = 77/104 (74%), Gaps = 2/104 (1%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRLT+R+R SY TKSNQ R+V+TPGGRLVYQY KK    P+C     K++GI   RPA
Sbjct: 1   MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA 60

Query: 211 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           E  RSRL   ++TV R YGGVL    V++RI+RAFL+EEQKIVK
Sbjct: 61  EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVK 104


>09_04_0106 -
           14636773-14636863,14636948-14637057,14638107-14638186,
           14638302-14638380
          Length = 119

 Score =  126 bits (305), Expect = 7e-30
 Identities = 63/104 (60%), Positives = 77/104 (74%), Gaps = 2/104 (1%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRLT+R+R SY TKSNQ R+V+TPGG+LVYQY KK    P+C     K++GI   RPA
Sbjct: 1   MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA 60

Query: 211 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           E  RSRL   ++TV R YGGVL    V++RI+RAFL+EEQKIVK
Sbjct: 61  EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVK 104


>03_05_0642 - 26346260-26346367,26347902-26348162,26348542-26349849,
            26349960-26350178,26350241-26350300,26352159-26352215,
            26352945-26353029,26353486-26353843,26353931-26355170
          Length = 1231

 Score = 28.7 bits (61), Expect = 2.6
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +1

Query: 64   SYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERS 219
            S N   NQ+R+V+  G +      +KP+++      + KL+G    RP  R+
Sbjct: 1123 SNNQSQNQQRLVQVGGKQGAA--TQKPQRLSNARPAREKLKGDNAKRPGSRT 1172


>01_05_0589 + 23459847-23460344,23460493-23461296
          Length = 433

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 10/27 (37%), Positives = 18/27 (66%)
 Frame = -3

Query: 224 RRERSAGLAGWIPRSLLLH*PHLGIFL 144
           R +R   + GW P+ L+L+ P +G+F+
Sbjct: 286 RGDRGRTIRGWAPQVLVLNHPAVGVFV 312


>08_02_1022 +
           23707993-23708528,23708620-23708706,23708807-23708863,
           23708955-23709261,23709545-23709631,23709720-23709767
          Length = 373

 Score = 27.1 bits (57), Expect = 8.0
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = -2

Query: 219 GTFSRSSWLDTTEFALALTTPWDLLGLFYILINQAA 112
           G + + SWL    FA+ALT  + L+    +LI Q A
Sbjct: 22  GVYLQRSWLVLLMFAVALTPTYVLMEDLLLLIGQPA 57


>02_05_0798 - 31810579-31811516,31811646-31811666,31811715-31812225
          Length = 489

 Score = 27.1 bits (57), Expect = 8.0
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = -3

Query: 227 QRRERSAGLAGWIPRSLLLH*PHLGIFL 144
           + +ER   LA W P+ L+L  P +G+FL
Sbjct: 354 ETKERGV-LASWCPQELVLSHPSVGLFL 380


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,882,486
Number of Sequences: 37544
Number of extensions: 230503
Number of successful extensions: 617
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 600
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 613
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 999806640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -