SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A17
         (656 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0812 + 23383704-23384143,23384902-23385247                      272   2e-73
06_01_0811 - 6113491-6113925,6114079-6114185,6114569-6114788,611...    33   0.20 
07_01_1201 - 11419851-11419913,11420090-11420311                       32   0.35 
03_03_0091 - 14371528-14372661                                         30   1.9  
06_01_0026 + 265755-265968,267319-267468,267694-267738,267786-26...    29   2.5  
02_05_0812 + 31942591-31942758,31943415-31943491,31944169-319443...    29   4.3  
01_07_0112 - 41149461-41151674,41151688-41153265,41154344-411555...    29   4.3  
04_01_0618 - 8094991-8097288                                           28   7.5  
03_03_0268 + 16047211-16047213,16047349-16047547,16047681-16047922     28   7.5  
11_06_0377 - 22900042-22900452,22900527-22902236                       27   9.9  
06_03_0828 + 25137782-25138312,25141349-25141588                       27   9.9  
02_03_0110 - 15350939-15352162,15352591-15353310,15353776-15353949     27   9.9  

>12_02_0812 + 23383704-23384143,23384902-23385247
          Length = 261

 Score =  272 bits (667), Expect = 2e-73
 Identities = 121/184 (65%), Positives = 151/184 (82%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A   F    + ER+GY+KGVV DIIHDPGRGAPLA V FR P+++K +KELF+A E
Sbjct: 23  RKGPA--RFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAKVTFRHPFRYKHQKELFVAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G+YTGQFVYCG++ATL +GNV+P+ ++PEG +VCN+E  +GDRG  ARASG++A VI HN
Sbjct: 81  GMYTGQFVYCGRRATLSIGNVLPIRSVPEGAVVCNVEHHVGDRGVFARASGDYAIVISHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           PD   +R+KLPSGAKK++PSS R M+G VAGGGR +KP+LKAG AYHKY+VKRNCWP VR
Sbjct: 141 PDNGTSRIKLPSGAKKIVPSSCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNCWPKVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/26 (73%), Positives = 20/26 (76%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRKGAGSVF SHT  RKG  + RSL
Sbjct: 7   AQRKGAGSVFKSHTHHRKGPARFRSL 32


>06_01_0811 -
           6113491-6113925,6114079-6114185,6114569-6114788,
           6115112-6115199,6115301-6115431,6115924-6116099,
           6116465-6116529,6117014-6117094,6117219-6117358,
           6117446-6117532,6117614-6117827,6118102-6118260,
           6118860-6118936,6119629-6119796
          Length = 715

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +2

Query: 554 WRWTY*QTYFESWKGIPQVQG 616
           W WTY  T+F SW  +P +QG
Sbjct: 70  WSWTYWSTFFLSWSIVPTLQG 90


>07_01_1201 - 11419851-11419913,11420090-11420311
          Length = 94

 Score = 32.3 bits (70), Expect = 0.35
 Identities = 17/62 (27%), Positives = 27/62 (43%)
 Frame = -2

Query: 571 SIRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARRPLSPIFSS 392
           ++ PPP  +P +P     R+   P G        +G  P        A  R+P +P+F S
Sbjct: 12  ALLPPPPPLPALPQGQQWRS-TGPTGKLCFCSFPAGALPPAAGAGQPAPDRQPATPLFPS 70

Query: 391 RL 386
           R+
Sbjct: 71  RV 72


>03_03_0091 - 14371528-14372661
          Length = 377

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 21/76 (27%), Positives = 31/76 (40%), Gaps = 2/76 (2%)
 Frame = -2

Query: 559 PPATIPTMPLLLDGRTFLAPDGS-FTLVRLASGLCPITVAKFPEARARRP-LSPIFSSRL 386
           PPA  P      D      P G+  T      G+ P + A    A A    L+P+F   +
Sbjct: 254 PPAPAPAPVKAEDALPHFFPQGAAVTATAHVHGVDPASAAASAAANAEGGILAPLFKEMV 313

Query: 385 HTMVPSGIAPTGITFP 338
             M+ +G+AP  +  P
Sbjct: 314 RAMLTAGMAPPSLEPP 329


>06_01_0026 +
           265755-265968,267319-267468,267694-267738,267786-268460,
           268779-268843,268854-269073,269163-269438,269547-269663,
           269776-269853,269930-270184,270235-270323,270403-270816
          Length = 865

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = +2

Query: 431 LWKLRHCDWT 460
           LWK RHCDWT
Sbjct: 73  LWKCRHCDWT 82


>02_05_0812 +
           31942591-31942758,31943415-31943491,31944169-31944327,
           31944559-31944772,31944849-31944935,31945022-31945161,
           31945380-31945460,31945948-31946012,31946219-31946394,
           31947212-31947342,31947438-31947525,31947671-31947884,
           31948206-31948312,31948456-31948953
          Length = 734

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 8/21 (38%), Positives = 13/21 (61%)
 Frame = +2

Query: 554 WRWTY*QTYFESWKGIPQVQG 616
           W W+Y  T+  +W  +P +QG
Sbjct: 70  WSWSYWSTFILTWAVVPTIQG 90


>01_07_0112 -
           41149461-41151674,41151688-41153265,41154344-41155507,
           41155807-41156293,41156603-41156759,41157303-41157378
          Length = 1891

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 9/30 (30%), Positives = 14/30 (46%)
 Frame = -3

Query: 462 CVQSQWRSFQRHVPDDLYHPFSLQDCTQWY 373
           C    W++   H+P  L H  +  +C  WY
Sbjct: 73  CSCGLWKATTHHLPSALCHGLNYVNCAMWY 102


>04_01_0618 - 8094991-8097288
          Length = 765

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 10/27 (37%), Positives = 16/27 (59%)
 Frame = +2

Query: 236 RSIQVQDKEGALHCSRRALHRPICLLW 316
           R  Q+ D++  + C+ R   +P CLLW
Sbjct: 434 RRNQMVDQQSVIWCAARMTKKPNCLLW 460


>03_03_0268 + 16047211-16047213,16047349-16047547,16047681-16047922
          Length = 147

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +3

Query: 462 NPDAKRTRVKLPS--GAKKVLPSSNRGMVGIVAGGGRIDKPI 581
           +P + RTR   PS  GA K    ++   +G+  GG R+  PI
Sbjct: 45  SPTSTRTRTSTPSAPGAAKAASPNHVRAIGVREGGARLVGPI 86


>11_06_0377 - 22900042-22900452,22900527-22902236
          Length = 706

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%)
 Frame = +3

Query: 324 ATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRL-ARASGNFATVIGHNPDAKRTRVK 491
           A L+ G   P+G + E   VC L +   D  R+ A  +G    + G  PD +  RV+
Sbjct: 373 AALDDGEERPLGGLVEELFVCRLGD--DDEVRVGANHNGEGRRLRGPRPDGEEARVR 427


>06_03_0828 + 25137782-25138312,25141349-25141588
          Length = 256

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSLXLR*TSWIHQGSC*GYNP*PW*RCTFG 220
           +R+G G+   SH ++R+G    R + +R  S +   S    +  PW R T G
Sbjct: 85  RRRGRGAARRSHAEERRGGAASREIAMR-RSGVAARSAASTHSTPWRRTTGG 135


>02_03_0110 - 15350939-15352162,15352591-15353310,15353776-15353949
          Length = 705

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 3/82 (3%)
 Frame = +3

Query: 345 VMPVGAMPEG---TIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKV 515
           V+PV    +G    +    E     RGR ARAS       G N  +KR R+ +P+ +  +
Sbjct: 469 VVPVTHFQQGWNAPVAIGGEHLYNQRGREARASDAIVINGGDNNLSKRKRLTVPARSNSL 528

Query: 516 LPSSNRGMVGIVAGGGRIDKPI 581
              +N     I +G  R+  PI
Sbjct: 529 --KNNMASNSIKSGSQRMWVPI 548


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,424,792
Number of Sequences: 37544
Number of extensions: 436652
Number of successful extensions: 1166
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1141
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1166
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1644004708
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -