SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A16
         (653 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0801 - 5993726-5994160,5994811-5994969,5995071-5995211,599...    33   0.15 
01_07_0081 - 40959279-40959375,40959463-40959589,40960138-409603...    30   1.4  
02_05_0300 + 27681204-27681656,27681745-27681840,27681933-276820...    29   2.4  
02_02_0663 - 12740733-12741104,12741260-12741326,12741709-127418...    28   5.6  
10_02_0117 + 5471920-5472401,5472602-5472668,5472956-5473012,547...    28   7.5  
02_02_0248 - 8267332-8268276,8268338-8269288                           28   7.5  
01_01_1010 - 7996921-7997673,7999212-7999399,7999688-7999784,800...    28   7.5  

>06_01_0801 -
           5993726-5994160,5994811-5994969,5995071-5995211,
           5995999-5996097,5996180-5996542,5996929-5997150,
           5997257-5997448,5997997-5998056,5998162-5998378,
           5998471-5998523,5999013-5999084,5999928-6000113,
           6000986-6001132,6002902-6003075,6003149-6003300,
           6004269-6004360,6004549-6004710,6004875-6005053,
           6005173-6005304,6005454-6005507,6006082-6006191,
           6006317-6006487,6006577-6006663,6008488-6008611,
           6009355-6009564
          Length = 1330

 Score = 33.5 bits (73), Expect = 0.15
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +2

Query: 260 QTNRVQQKIQVGQAPILHLIHTDSHLITQ--EKGGKLKVFELTNSGYEEDAVIEVDYPGF 433
           +T ++ Q     +A I  LIH    L        G +KVF  +   +E++    V++P  
Sbjct: 107 RTRKLDQAALETEARITPLIHEKKRLFNDLLTLKGNVKVFCRSRPLFEDEGSSVVEFPDD 166

Query: 434 CRFEANTKLASLYVPEKDYKIN 499
                NT   SL  P+KDY+ +
Sbjct: 167 FTIRVNTGDESLTNPKKDYEFD 188


>01_07_0081 -
           40959279-40959375,40959463-40959589,40960138-40960339,
           40962414-40963361
          Length = 457

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +2

Query: 149 RNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTN 268
           R  D   +YSLAFS     L+ L   S  G ++ +NL+ N
Sbjct: 319 RGADRAEIYSLAFS---NNLQYLAVSSDKGTIHVFNLKIN 355


>02_05_0300 +
           27681204-27681656,27681745-27681840,27681933-27682022,
           27682126-27682227,27682310-27682456,27683608-27683748,
           27683749-27683808,27685133-27685230,27685308-27685410,
           27685954-27686037
          Length = 457

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +2

Query: 194 LPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQ 298
           LP G ++L +GSK+G V  ++ QT +    I +G+
Sbjct: 158 LPAGSDKLYSGSKDGTVRMWDCQTGQCAGVINMGR 192


>02_02_0663 -
           12740733-12741104,12741260-12741326,12741709-12741809,
           12741852-12742273,12743678-12743685,12745164-12745396
          Length = 400

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +2

Query: 209 ERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAP 304
           + L +GS +G +Y Y+ +++R+  KIQ  + P
Sbjct: 342 KELTSGSSDGCIYFYDYKSSRLLSKIQAFKEP 373


>10_02_0117 +
           5471920-5472401,5472602-5472668,5472956-5473012,
           5473301-5473538,5476504-5476611,5476868-5477111,
           5478307-5478550,5478636-5478842
          Length = 548

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = -2

Query: 484 LLRYIE*CEFCVGFESTKTRIIYFNYGIFF 395
           LLRY +   F     ST+ RI+YF Y I F
Sbjct: 137 LLRYSDSSFFGTAHISTQLRIVYFQYNIRF 166


>02_02_0248 - 8267332-8268276,8268338-8269288
          Length = 631

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +2

Query: 557 KLGDVMCLKFIEFPCDRPXSTSWLRSRLAL 646
           +L DV+   F++FP   P   ++LRS LAL
Sbjct: 231 ELQDVLMELFVDFPAPYPRRLAYLRSFLAL 260


>01_01_1010 -
           7996921-7997673,7999212-7999399,7999688-7999784,
           8000420-8000767,8001130-8001231,8001432-8001501,
           8001747-8001802,8001891-8002010
          Length = 577

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +2

Query: 356 GKLKVFELTNSGYEEDAVIEVDYP 427
           G+L+  EL +S   +DAV+E+D P
Sbjct: 526 GRLRFLELRHSDVVDDAVLEIDAP 549


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,461,856
Number of Sequences: 37544
Number of extensions: 292768
Number of successful extensions: 655
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 647
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 655
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1632177336
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -