SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A15
         (409 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_07_0172 + 13804803-13805293,13805423-13805537,13805766-138058...    38   0.002
03_01_0468 - 3612079-3612197,3612679-3612850                           29   1.1  

>10_07_0172 +
           13804803-13805293,13805423-13805537,13805766-13805831,
           13805921-13806009,13806103-13806193,13806312-13806458,
           13806575-13806667,13806745-13806846,13806957-13807541,
           13808523-13808813,13808866-13808937
          Length = 713

 Score = 38.3 bits (85), Expect = 0.002
 Identities = 20/59 (33%), Positives = 27/59 (45%)
 Frame = -1

Query: 265 SQPPSFTFRFKKSEDVSVTDGSFHVSDDLTAGLPNELDLHLSTLALRTSTAKHFHDTSK 89
           +QPP    R ++ EDV++TD +  V  D T  +  EL   L  L      A H H   K
Sbjct: 605 AQPPGLPLRLEQGEDVALTDRALDVPHDETVLVVEELHSDLGHLTPGAGAAHHLHHDGK 663


>03_01_0468 - 3612079-3612197,3612679-3612850
          Length = 96

 Score = 29.5 bits (63), Expect = 1.1
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -1

Query: 265 SQPPSFTFRFKKSEDVSVTDGSFHVSDDLTAGLPNELDLHLSTL 134
           ++PP      ++ EDV++++ +  V  D T  +  ELD HL  L
Sbjct: 10  AKPPGLPLGLEQGEDVALSNRALDVPHDETVLVIQELDSHLGHL 53


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,369,714
Number of Sequences: 37544
Number of extensions: 185656
Number of successful extensions: 433
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 427
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 433
length of database: 14,793,348
effective HSP length: 75
effective length of database: 11,977,548
effective search space used: 718652880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -