SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A11
         (457 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_0648 + 20257442-20257528,20257688-20257867,20258055-202581...    70   1e-12
07_03_0646 + 20250684-20250686,20251522-20251701,20251899-202519...    70   1e-12
07_03_0643 + 20239224-20239310,20239470-20239649,20239837-202399...    70   1e-12
07_03_0641 + 20214245-20214247,20215086-20215265,20215463-202155...    70   1e-12
07_03_0640 + 20207497-20207554,20208457-20208482,20208522-202087...    70   1e-12
07_03_0639 + 20203902-20203988,20204152-20204331,20204529-202046...    70   1e-12
07_03_0226 + 15395380-15395382,15396993-15397172,15397286-153973...    70   1e-12
07_03_0645 + 20244889-20244942,20245331-20245405,20245502-20245561     53   1e-07
06_01_0415 + 2958746-2959110,2960468-2960593,2961314-2961998           30   1.0  
01_07_0075 + 40908875-40909069,40909147-40909215,40909363-409094...    28   3.1  
02_01_0043 + 300122-300907,301447-301722,302347-302481                 28   4.1  
10_01_0049 - 668482-669283,669596-670131,670235-670452,670554-67...    27   5.4  
08_01_0962 + 9627728-9627853,9627961-9628188,9628447-9628455           27   5.4  
03_03_0063 - 14176137-14176769,14178220-14178513,14178966-14179058     27   5.4  
12_01_0638 - 5376164-5376247,5376734-5380517,5382029-5382045           27   7.2  
03_05_0671 + 26608953-26609671,26609775-26610495                       27   9.5  

>07_03_0648 +
           20257442-20257528,20257688-20257867,20258055-20258129,
           20258230-20258289
          Length = 133

 Score = 69.7 bits (163), Expect = 1e-12
 Identities = 30/52 (57%), Positives = 36/52 (69%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           YGGQ+KP+F         IVL+L+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 78  YGGQTKPVFHKKAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKG 129



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = +3

Query: 114 VNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQG 221
           VNVPK ++TY              +QYKK K+  +AQG
Sbjct: 30  VNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQG 67



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 KNVNATKYTRYHST--KSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           KN    K+T +  T  K  +     + +RRYDRKQ G     +    K+ K
Sbjct: 41  KNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAK 91


>07_03_0646 +
           20250684-20250686,20251522-20251701,20251899-20251973,
           20252072-20252131
          Length = 105

 Score = 69.7 bits (163), Expect = 1e-12
 Identities = 30/52 (57%), Positives = 36/52 (69%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           YGGQ+KP+F         IVL+L+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 50  YGGQTKPVFHKKAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKG 101



 Score = 29.5 bits (63), Expect = 1.3
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = +3

Query: 111 MVNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK ++TY              +QYKK K+  +AQG
Sbjct: 1   MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQG 39



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 KNVNATKYTRYHST--KSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           KN    K+T +  T  K  +     + +RRYDRKQ G     +    K+ K
Sbjct: 13  KNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAK 63


>07_03_0643 +
           20239224-20239310,20239470-20239649,20239837-20239911,
           20240012-20240071
          Length = 133

 Score = 69.7 bits (163), Expect = 1e-12
 Identities = 30/52 (57%), Positives = 36/52 (69%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           YGGQ+KP+F         IVL+L+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 78  YGGQTKPVFHKKAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKG 129



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = +3

Query: 114 VNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQG 221
           VNVPK ++TY              +QYKK K+  +AQG
Sbjct: 30  VNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQG 67



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 KNVNATKYTRYHST--KSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           KN    K+T +  T  K  +     + +RRYDRKQ G     +    K+ K
Sbjct: 41  KNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAK 91


>07_03_0641 +
           20214245-20214247,20215086-20215265,20215463-20215537,
           20215636-20215695
          Length = 105

 Score = 69.7 bits (163), Expect = 1e-12
 Identities = 30/52 (57%), Positives = 36/52 (69%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           YGGQ+KP+F         IVL+L+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 50  YGGQTKPVFHKKAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKG 101



 Score = 29.5 bits (63), Expect = 1.3
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = +3

Query: 111 MVNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK ++TY              +QYKK K+  +AQG
Sbjct: 1   MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQG 39



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 KNVNATKYTRYHST--KSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           KN    K+T +  T  K  +     + +RRYDRKQ G     +    K+ K
Sbjct: 13  KNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAK 63


>07_03_0640 +
           20207497-20207554,20208457-20208482,20208522-20208701,
           20208891-20208965,20209062-20209121
          Length = 132

 Score = 69.7 bits (163), Expect = 1e-12
 Identities = 30/52 (57%), Positives = 36/52 (69%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           YGGQ+KP+F         IVL+L+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 77  YGGQTKPVFHKKAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKG 128



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = +3

Query: 114 VNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQG 221
           VNVPK ++TY              +QYKK K+  +AQG
Sbjct: 29  VNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQG 66



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 KNVNATKYTRYHST--KSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           KN    K+T +  T  K  +     + +RRYDRKQ G     +    K+ K
Sbjct: 40  KNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAK 90


>07_03_0639 +
           20203902-20203988,20204152-20204331,20204529-20204603,
           20204696-20204755
          Length = 133

 Score = 69.7 bits (163), Expect = 1e-12
 Identities = 30/52 (57%), Positives = 36/52 (69%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           YGGQ+KP+F         IVL+L+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 78  YGGQTKPVFHKKAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKG 129



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = +3

Query: 114 VNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQG 221
           VNVPK ++TY              +QYKK K+  +AQG
Sbjct: 30  VNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQG 67



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 KNVNATKYTRYHST--KSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           KN    K+T +  T  K  +     + +RRYDRKQ G     +    K+ K
Sbjct: 41  KNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAK 91


>07_03_0226 +
           15395380-15395382,15396993-15397172,15397286-15397360,
           15397466-15397525
          Length = 105

 Score = 69.7 bits (163), Expect = 1e-12
 Identities = 30/52 (57%), Positives = 36/52 (69%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           YGGQ+KP+F         IVL+L+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 50  YGGQTKPVFHKKAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKG 101



 Score = 29.5 bits (63), Expect = 1.3
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = +3

Query: 111 MVNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK ++TY              +QYKK K+  +AQG
Sbjct: 1   MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQG 39



 Score = 27.5 bits (58), Expect = 5.4
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 KNVNATKYTRYHST--KSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           KN    K+T +  T  K  +     + +RRYDRKQ G     +    K+ K
Sbjct: 13  KNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAK 63


>07_03_0645 + 20244889-20244942,20245331-20245405,20245502-20245561
          Length = 62

 Score = 53.2 bits (122), Expect = 1e-07
 Identities = 22/34 (64%), Positives = 27/34 (79%)
 Frame = +2

Query: 308 IVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           IVL+L+C  CK  SQ  +KRCKHF++GGDKK KG
Sbjct: 25  IVLKLQCQSCKHYSQHPIKRCKHFKIGGDKKGKG 58


>06_01_0415 + 2958746-2959110,2960468-2960593,2961314-2961998
          Length = 391

 Score = 29.9 bits (64), Expect = 1.0
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +1

Query: 130 SAGRTAKNVNATKYTRYHSTKSPRKGTLPRXRRRY 234
           S+GRTA++    +  R+H T   RKG LPR   ++
Sbjct: 99  SSGRTARDAAVAQQERHHDTIKRRKG-LPRWTEKF 132


>01_07_0075 +
           40908875-40909069,40909147-40909215,40909363-40909461,
           40909999-40910078,40910162-40910444,40910557-40910580,
           40911039-40911700,40912037-40912121,40912203-40912254,
           40912336-40912385,40912450-40912497,40912590-40912766
          Length = 607

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 6/45 (13%)
 Frame = -1

Query: 250 PAVYDHNVFXPWAACLSLDFLYCDTLCT------LWHLHFLQYVL 134
           P + D+N F   AA   LD     T+CT      LW  +FLQY L
Sbjct: 45  PKLNDNNAFRVLAAASFLDLQDLCTICTDFIISELWTSNFLQYQL 89


>02_01_0043 + 300122-300907,301447-301722,302347-302481
          Length = 398

 Score = 27.9 bits (59), Expect = 4.1
 Identities = 13/29 (44%), Positives = 15/29 (51%)
 Frame = -2

Query: 411 CPFLFLSPPSSKCLHLFNATCDLTLQSAH 325
           CP  F SPPSS C   F ++ DL     H
Sbjct: 45  CPLGFTSPPSSSCPLGFTSSYDLDAAFHH 73


>10_01_0049 -
           668482-669283,669596-670131,670235-670452,670554-670653,
           670706-670855
          Length = 601

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 12/85 (14%)
 Frame = -2

Query: 234 ITSSXPGQRAFPWTFCTV------------IPCVLCGIYIFCSTSCAVLVRSPFLSSFGT 91
           IT+S     + PW  CTV            +P  L G+    + +C  L    F+   G 
Sbjct: 343 ITASDEASASRPWKLCTVTQVEELKIFARMLPIFLTGVIFNTAEACFPL----FVEQGGA 398

Query: 90  ISTNVKKRYFNPAMTLDTLTFFCLI 16
           +  +V   +  P  +L T T  C++
Sbjct: 399 MDNHVAAAFALPPASLTTFTCVCIL 423


>08_01_0962 + 9627728-9627853,9627961-9628188,9628447-9628455
          Length = 120

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
 Frame = +1

Query: 175 RYHSTKSPR--KGTLPRXRRRYDRKQQGLRWSVQTHLQKE 288
           R HS+ SP   +GT PR  +     ++  RW  Q  L++E
Sbjct: 3   RPHSSSSPCPCQGTAPRCGKNEGGVEESTRWQEQQQLEEE 42


>03_03_0063 - 14176137-14176769,14178220-14178513,14178966-14179058
          Length = 339

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 12/42 (28%), Positives = 18/42 (42%)
 Frame = -3

Query: 452 QWSYLLEAFKIGSSVPFSSCHHRAQSACISSMQPVISPCNLH 327
           +W +  E F+ G+    S  H R  S+C     P   P + H
Sbjct: 138 RWEFANEFFRKGAKHLLSEIHRRKSSSCSQPQPPPPFPMHQH 179


>12_01_0638 - 5376164-5376247,5376734-5380517,5382029-5382045
          Length = 1294

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -1

Query: 235  HNVFXPWAACLSLDFLYCDTLCTLWHLHFLQYVL 134
            H+VF    +  SL+ + C+ L +L  L  LQY+L
Sbjct: 1062 HDVFKSLKSLKSLEIIGCENLSSLGGLGSLQYLL 1095


>03_05_0671 + 26608953-26609671,26609775-26610495
          Length = 479

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 353 VALKRCKHFELGGDKKRKGQMIQF*MLLINK 445
           +A + CKHFE    + R G  I+  ++ INK
Sbjct: 357 IAAQDCKHFEAASYEDRNGNSIRNVIVPINK 387


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,516,655
Number of Sequences: 37544
Number of extensions: 213651
Number of successful extensions: 594
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 568
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 587
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 895500300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -