SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_0550 - 30151494-30151526,30151620-30151706,30152458-301526...   166   1e-41
02_02_0153 - 7258002-7258034,7258137-7258223,7258991-7259161,725...   163   1e-40
06_03_0440 + 20815528-20815653,20815742-20815912,20816501-208165...   131   2e-35
01_01_0502 - 3688940-3689149,3689180-3689251,3690028-3690064,369...    30   1.9  
01_06_0355 + 28657833-28660665,28660762-28661126                       29   4.3  
01_06_1355 + 36610390-36610479,36611906-36612063,36612144-366125...    28   7.5  
01_05_0740 - 24809951-24810394,24810622-24810700,24811651-248118...    27   9.9  

>01_06_0550 -
           30151494-30151526,30151620-30151706,30152458-30152628,
           30152716-30152757,30152856-30152939
          Length = 138

 Score =  166 bits (404), Expect = 1e-41
 Identities = 77/115 (66%), Positives = 95/115 (82%), Gaps = 1/115 (0%)
 Frame = +1

Query: 106 TIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTP-DVVFVFGFKTNF 282
           T+RTRKFMTNRLL+RKQ V +V+HPG+P VSK E++EKLAK+Y+V   + +FVF F+T+F
Sbjct: 11  TLRTRKFMTNRLLSRKQFVLEVIHPGRPNVSKAELKEKLAKLYEVKDANCIFVFKFRTHF 70

Query: 283 GGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRG 447
           GGGKSTGF LIYD LD AKK+EPK+RL R+GL  K   +RKQ KERKNR KK+RG
Sbjct: 71  GGGKSTGFGLIYDNLDAAKKYEPKYRLIRNGLATKVEKSRKQMKERKNRAKKIRG 125


>02_02_0153 -
           7258002-7258034,7258137-7258223,7258991-7259161,
           7259261-7259386
          Length = 138

 Score =  163 bits (395), Expect = 1e-40
 Identities = 76/115 (66%), Positives = 94/115 (81%), Gaps = 1/115 (0%)
 Frame = +1

Query: 106 TIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTP-DVVFVFGFKTNF 282
           T+RTRKFMTNRLL+RKQ V +VLHPG+  VSK +++EKLAK+Y+V   + +FVF F+T+F
Sbjct: 11  TLRTRKFMTNRLLSRKQFVLEVLHPGRANVSKADLKEKLAKLYEVKDSNCIFVFKFRTHF 70

Query: 283 GGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRG 447
           GGGKSTGF LIYD LD AKK+EPK+RL R+GL  K   +RKQ KERKNR KK+RG
Sbjct: 71  GGGKSTGFGLIYDNLDAAKKYEPKYRLIRNGLATKVEKSRKQMKERKNRAKKIRG 125


>06_03_0440 +
           20815528-20815653,20815742-20815912,20816501-20816584,
           20818831-20818917,20819044-20819076
          Length = 166

 Score =  131 bits (316), Expect(2) = 2e-35
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +1

Query: 106 TIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKV-TPDVVFVFGFKTNF 282
           T+RTRKFMTNRLL+RKQ V +VLHPG+  VSK +++EKLAK+Y+V   + +FVF F+T+F
Sbjct: 11  TLRTRKFMTNRLLSRKQFVLEVLHPGRANVSKADLKEKLAKLYEVKDSNCIFVFKFRTHF 70

Query: 283 GGGKSTGFALIYDTLDLAKKFEPKHRLAR 369
           GGGKSTGF LIYD LD AKK+EPK+RL R
Sbjct: 71  GGGKSTGFGLIYDNLDAAKKYEPKYRLIR 99



 Score = 35.9 bits (79), Expect(2) = 2e-35
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = +1

Query: 370 HGLYEKKRPTRKQRKERKNRMKKVRG 447
           +GL  K   +RKQ KERKNR KK+RG
Sbjct: 128 NGLATKVEKSRKQMKERKNRAKKIRG 153


>01_01_0502 -
           3688940-3689149,3689180-3689251,3690028-3690064,
           3691224-3691705
          Length = 266

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +3

Query: 300 WIRFDLRHTRSGQEVRAQAQVSPPRPVREEEAHA 401
           W R  +R +  G E    AQ+ PPRPV  + +HA
Sbjct: 155 WSRL-VRTSEHGDEQLTGAQLRPPRPVEADASHA 187


>01_06_0355 + 28657833-28660665,28660762-28661126
          Length = 1065

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = -1

Query: 266 PNTNTTSGVTLYILASFSRISVLLTVGFPGCKTSQTICLRANNLLVMNLRVRIVAVPSLI 87
           PN    S +TL  L   + +  L  +GFP CK    +  + + LL      ++V +PS++
Sbjct: 670 PNGGVFSNITLQSLRGNTALCGLPRLGFPHCKNDHPLQGKKSRLL------KVVLIPSIL 723


>01_06_1355 +
           36610390-36610479,36611906-36612063,36612144-36612523,
           36612600-36613583,36614228-36614292,36614946-36615024,
           36615480-36615529,36616595-36616781,36617922-36617957,
           36619226-36619348,36619466-36620386,36620506-36620636
          Length = 1067

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = -1

Query: 215 SRISVLLTVGFPGCKTSQTICLRANNLLVMNLRVRIVAVPSLI 87
           +R+ V + +GF  C+  QT C R+  +++ N+     A+P+ +
Sbjct: 364 TRMLVTVGLGFSSCQPEQTQCNRSAPVVLANMNNVSFALPNTV 406


>01_05_0740 - 24809951-24810394,24810622-24810700,24811651-24811809,
            24812083-24812246,24812436-24812624,24813151-24813408,
            24813463-24813951,24814062-24814262,24814368-24814639,
            24814661-24814685,24814776-24814937,24815065-24815104,
            24815244-24815353,24815812-24815898,24816013-24816507
          Length = 1057

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = +1

Query: 373  GLYEKKRPTRKQRKERKNRMKK 438
            G+YE++R  R+Q KER+ +  K
Sbjct: 999  GVYERERNMRQQEKERRKQQSK 1020


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,086,568
Number of Sequences: 37544
Number of extensions: 353953
Number of successful extensions: 999
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 963
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 991
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1632177336
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -