SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A09
         (627 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_07_0039 - 27239362-27239478,27240570-27241463                      125   3e-29
01_06_0303 + 28324155-28325045,28326208-28326321                      124   4e-29
06_03_0967 - 26395537-26396590,26400918-26401111                       60   1e-09
11_06_0263 + 21777178-21777342,21777742-21777823,21777939-217780...    54   1e-09
03_05_0969 + 29283905-29284570,29284862-29284930,29286533-292866...    58   8e-09
03_02_1033 + 13550955-13551700,13552837-13553290,13553451-135536...    55   5e-08
03_02_1031 + 13541327-13542072,13543209-13543662,13543823-135440...    55   5e-08
10_01_0025 - 328105-328188,328281-328337,328680-328734,328809-32...    54   9e-08
02_02_0017 - 6131265-6131284,6131654-6131774,6132011-6132146,613...    54   1e-07
03_05_0621 - 26198985-26199020,26199539-26199652,26200260-262006...    53   2e-07
06_01_0320 - 2320317-2320336,2320791-2320902,2321092-2321236,232...    52   3e-07
03_03_0256 + 15898702-15900420                                         52   4e-07
04_04_0990 - 29955207-29955551,29955639-29955813,29955887-299560...    51   9e-07
03_02_0939 + 12571052-12571173,12571219-12571309,12571413-125715...    51   9e-07
04_04_1592 - 34649484-34649547,34650118-34650186,34650325-346504...    50   2e-06
02_02_0528 + 11199799-11200470,11201850-11201951,11202858-112034...    49   3e-06
12_01_0418 - 3304741-3304904,3305579-3305762,3307254-3307347,330...    48   6e-06
01_06_0923 + 33044283-33044433,33044826-33045242,33046209-330465...    46   2e-05
09_01_0139 - 2074193-2077146,2077549-2078043,2078983-2079190           46   3e-05
06_03_0940 + 26145746-26145879,26146740-26146821,26147349-261474...    46   3e-05
03_05_0886 - 28516210-28519163,28519577-28520071,28520757-28520964     46   3e-05
09_06_0328 + 22365308-22365415,22365743-22366018,22366166-223664...    45   4e-05
02_02_0241 - 8204430-8205398                                           45   4e-05
10_08_0305 - 16644276-16644290,16644611-16645258,16646764-166468...    45   6e-05
08_01_0255 + 2089543-2089583,2089696-2090089,2090797-2090862,209...    45   6e-05
08_01_0058 + 388989-389102,389226-389337,389457-389483,389787-38...    45   6e-05
11_01_0705 - 5795976-5796051,5796450-5796518,5796632-5796780,579...    44   8e-05
10_08_0491 - 18283404-18283482,18283590-18283658,18283767-182838...    44   8e-05
07_03_0971 + 23038409-23039134,23040321-23040611                       44   8e-05
02_02_0016 - 6118739-6118758,6119116-6119236,6119478-6119613,611...    44   8e-05
11_06_0627 + 25633537-25633884,25635246-25635869                       43   2e-04
04_04_0835 + 28538032-28539006,28539113-28539203,28539291-285394...    43   2e-04
07_01_0174 - 1227871-1228043,1228303-1228423,1228519-1228588,122...    42   3e-04
07_03_0011 + 12370624-12370684,12372573-12372718,12372793-123731...    42   4e-04
03_05_0724 - 27147479-27147706,27147830-27147920,27148002-271480...    42   4e-04
01_01_0974 + 7678211-7678276,7678974-7679063,7679144-7679255,767...    42   4e-04
06_03_0914 + 25920277-25920405,25920783-25920810,25920890-259209...    42   5e-04
03_05_0887 - 28527602-28530555,28531296-28531790,28532377-28532584     42   5e-04
01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677...    41   7e-04
01_06_0898 - 32832665-32832724,32832761-32832815,32832957-328331...    41   7e-04
01_03_0084 - 12286416-12286514,12286632-12286683,12286771-122868...    41   7e-04
09_06_0121 + 20975132-20975755,20976834-20976977,20977333-209774...    41   0.001
11_01_0559 - 4406815-4406922,4408954-4409042,4409177-4409270,440...    40   0.001
01_04_0102 + 16030094-16030462,16030595-16030714,16031715-160317...    40   0.001
01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902,467...    40   0.002
02_04_0149 + 20201674-20201891,20202009-20202111,20202658-202027...    39   0.003
10_08_0299 - 16607152-16607322,16607465-16607785,16607870-166081...    39   0.004
04_04_0589 + 26449184-26450500,26452220-26452310,26452428-264525...    39   0.004
10_08_0316 - 16688911-16689044,16689141-16689211,16689303-166893...    38   0.005
04_04_1180 - 31519713-31521419,31522308-31522533,31524097-31524215     38   0.005
01_05_0816 + 25462571-25462630,25462752-25462838,25462929-254629...    38   0.005
11_01_0702 - 5782202-5782277,5782692-5782760,5782878-5783026,578...    38   0.009
03_05_1112 + 30488678-30488806,30489047-30489228,30489310-304895...    38   0.009
03_05_0700 + 26920743-26920771,26920880-26920991,26921205-269213...    38   0.009
12_01_0503 - 3981603-3981730,3982858-3983023,3983057-3983139,398...    37   0.011
02_04_0131 - 20046033-20046505,20047140-20047233,20047343-200474...    37   0.011
08_02_0130 - 12900202-12900277,12901457-12901536,12901654-129017...    37   0.015
04_04_0454 + 25348189-25348516,25349154-25349869                       37   0.015
03_05_0802 - 27823213-27823701,27823911-27823959,27824053-278241...    37   0.015
01_01_0272 - 2249662-2249721,2250110-2250335,2250419-2250615,225...    37   0.015
05_04_0278 - 19694590-19694757,19696331-19696391,19696503-196966...    36   0.020
04_04_0270 - 24061852-24063264                                         36   0.020
04_03_0897 - 20646750-20646918,20647927-20648038,20649650-206501...    36   0.020
02_01_0283 + 1903869-1904786                                           36   0.020
09_02_0319 + 7217262-7217372,7218026-7218121,7218642-7218771,721...    36   0.026
03_01_0320 - 2510907-2512190                                           36   0.026
02_05_0698 + 31005555-31006763                                         36   0.026
01_05_0653 - 23948911-23948937,23949031-23949141,23949361-239494...    36   0.026
05_01_0316 + 2476689-2477030,2477164-2477283,2477742-2477819,247...    36   0.035
03_01_0363 + 2827990-2828055,2828215-2829306,2829715-2829837,282...    36   0.035
05_06_0102 - 25589011-25589181,25589269-25589496,25589589-255899...    35   0.046
05_03_0185 + 9348559-9348958,9349560-9349687,9349782-9349808,935...    35   0.061
04_04_1596 + 34684943-34686340,34688085-34688175,34688290-346883...    35   0.061
04_04_0475 + 25500470-25500609,25500697-25500794,25502806-255029...    35   0.061
02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198,336...    35   0.061
08_01_0515 - 4490855-4490902,4490992-4491072,4491752-4491823,449...    34   0.080
07_01_0972 - 8176013-8176960                                           34   0.080
06_03_1454 - 30261240-30261470,30261896-30262615,30262700-302628...    34   0.080
06_03_0175 + 17553447-17553667,17555313-17555467,17555625-175557...    34   0.080
09_03_0044 - 11855569-11855664,11855775-11855891,11856572-118566...    34   0.11 
03_01_0161 + 1307206-1307769,1307979-1308101,1308182-1308286,130...    34   0.11 
08_02_1540 + 27694565-27694579,27696364-27696447,27696599-276967...    33   0.14 
03_01_0107 + 849489-850652,850745-850835,850926-851083,851180-85...    33   0.14 
01_05_0652 - 23934604-23934636,23934783-23934893,23935000-239351...    33   0.14 
01_01_0166 + 1412918-1413309,1413845-1414006,1414534-1414720,141...    33   0.14 
08_02_1111 + 24377268-24377444,24377543-24377630,24378072-243781...    33   0.19 
03_05_0378 - 23619169-23619225,23619389-23619454,23620052-236202...    33   0.19 
02_05_1194 - 34881450-34881593,34882023-34882220,34882522-348826...    33   0.19 
02_05_0890 - 32546918-32547088,32547224-32547334,32547705-325478...    33   0.19 
03_02_0614 + 9863622-9863675,9864353-9864604,9865125-9865268,986...    33   0.25 
02_05_0300 + 27681204-27681656,27681745-27681840,27681933-276820...    33   0.25 
02_05_0220 - 26885502-26885561,26885940-26886739,26887055-268874...    33   0.25 
01_03_0103 - 12567986-12568141,12568307-12568442,12568751-125688...    33   0.25 
01_01_0911 - 7176355-7176372,7176502-7176756,7177352-7177615,717...    33   0.25 
05_07_0181 - 28225396-28225587,28226009-28226068,28226150-282264...    32   0.32 
01_01_0542 + 3975500-3975546,3976273-3976370,3976694-3976830,397...    32   0.32 
11_01_0699 - 5757410-5757458,5757760-5757831,5758084-5758152,575...    32   0.43 
06_03_1130 - 27826384-27827039,27827800-27828031,27828120-278284...    32   0.43 
06_01_0936 - 7220333-7220508,7221208-7221327,7221898-7223089           32   0.43 
05_04_0355 - 20577189-20577275,20578001-20578129,20578252-205783...    32   0.43 
05_04_0022 - 17217626-17217643,17217740-17217856,17217987-172181...    32   0.43 
03_05_0448 - 24426509-24426737,24427306-24427401,24427723-244278...    32   0.43 
03_02_0099 - 5614007-5614233,5614725-5614998,5615086-5616179,561...    32   0.43 
01_05_0439 - 22159425-22159520,22160137-22160345,22161028-221610...    32   0.43 
10_08_0810 + 20734490-20734606,20735182-20735433,20735521-207356...    31   0.57 
07_03_1101 + 23967298-23967366,23968918-23969021,23969616-239697...    31   0.57 
07_01_1005 + 8509777-8509968,8510059-8510205,8510326-8510544,851...    31   0.57 
07_01_0853 + 6982185-6983593,6985926-6986497,6987139-6988439           31   0.57 
06_03_0482 + 21307314-21307458,21308747-21308850,21308924-213090...    31   0.57 
03_06_0560 + 34726338-34727243                                         31   0.57 
03_05_0373 + 23581812-23583293                                         31   0.57 
02_02_0663 - 12740733-12741104,12741260-12741326,12741709-127418...    31   0.57 
01_07_0014 - 40455673-40455723,40455815-40455892,40455987-404560...    31   0.57 
12_02_0971 + 24949137-24950534                                         31   0.75 
07_03_1570 + 27797315-27797409,27797519-27797551,27798135-277981...    31   0.75 
07_03_0153 - 14481421-14481506,14481933-14482111,14483046-144831...    31   0.75 
06_02_0064 + 11062798-11063568,11064212-11064261,11064354-110645...    31   0.75 
03_02_0702 + 10526895-10526958,10527141-10527284,10528028-105281...    31   0.75 
01_07_0350 + 42941976-42942401,42942510-42942737,42943201-429433...    31   0.75 
03_05_1096 - 30364144-30365310,30365825-30365971,30366087-303663...    31   0.99 
08_02_0632 + 19515234-19515374,19515489-19515656,19518907-195189...    30   1.3  
08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366...    30   1.3  
08_01_0253 + 2072766-2072954,2073526-2073591,2073755-2073877,207...    30   1.3  
07_03_1163 - 24439976-24440023,24440562-24440597,24440932-244410...    30   1.3  
07_01_0745 + 5691926-5692095,5692654-5692735,5693256-5693334,569...    30   1.3  
06_02_0200 - 12946139-12946282,12947636-12947842,12949506-129496...    30   1.3  
04_04_0751 - 27769616-27769684,27769795-27769917,27769998-277707...    30   1.3  
03_04_0228 - 18989688-18989807,18990300-18990345,18990452-189905...    30   1.3  
03_03_0181 + 15162681-15162806,15164026-15164172,15164269-151643...    30   1.3  
02_05_0568 - 30034280-30034393,30034888-30035163,30035246-300353...    30   1.3  
02_01_0790 + 5925048-5925165,5926133-5926268,5926832-5926913,592...    30   1.3  
06_03_0662 - 23229957-23230204,23231021-23231160,23231257-232313...    29   2.3  
02_05_0559 - 29953309-29953722,29953852-29953938,29954280-299543...    29   2.3  
05_06_0264 + 26756337-26756411,26756494-26756594,26757196-267573...    29   3.0  
01_07_0161 + 41574749-41576044                                         29   3.0  
09_02_0022 + 3065644-3065953,3066048-3067162,3067261-3067437,306...    29   4.0  
07_01_0057 + 431084-431105,431149-431297,431380-431526,431622-43...    29   4.0  
06_03_0306 - 19396423-19397112,19397645-19397916,19398047-19398215     29   4.0  
03_06_0704 + 35641774-35642031,35642122-35642446,35642546-356426...    29   4.0  
03_05_1065 + 30061588-30061883,30061995-30062056,30062196-300622...    29   4.0  
12_02_1112 + 26162188-26162877,26163263-26163634                       28   5.3  
03_05_1069 + 30118930-30120120                                         28   5.3  
03_01_0082 + 653041-653137,653219-653496,653596-653689,653804-65...    28   5.3  
02_05_0420 + 28821717-28821854,28821944-28822210,28822299-288225...    28   5.3  
02_05_0076 + 25637752-25639062,25639221-25639297,25640962-256410...    28   5.3  
01_06_0102 - 26447286-26448107,26448248-26448385,26448990-264493...    28   5.3  
07_03_1093 + 23912303-23912467,23912671-23912801,23913079-239130...    28   7.0  
06_01_0218 + 1647624-1647757,1648044-1648112,1648493-1648549,164...    28   7.0  
05_03_0376 - 13252220-13252354,13252433-13252541,13253279-132533...    28   7.0  
06_03_0541 - 21944696-21944851,21944939-21945142,21945438-219474...    27   9.2  
01_05_0495 + 22705697-22705765,22705903-22706025,22708429-227085...    27   9.2  

>05_07_0039 - 27239362-27239478,27240570-27241463
          Length = 336

 Score =  125 bits (302), Expect = 3e-29
 Identities = 64/115 (55%), Positives = 74/115 (64%), Gaps = 11/115 (9%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN-----------N 193
           E+L L G LRGHN  VT IA        I+SSSRDK+L+VW +T                
Sbjct: 5   ESLTLAGVLRGHNDMVTAIAAPIDNSPFIVSSSRDKSLLVWDITNPSTAVATDPEAAPPE 64

Query: 194 YGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           YG+  +RL GHSHF+ DVVLSSDG +ALSGSWD  LRLWDLA G+TTRRF  HTK
Sbjct: 65  YGVSYRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGRTTRRFVGHTK 119



 Score = 59.3 bits (137), Expect = 2e-09
 Identities = 34/90 (37%), Positives = 50/90 (55%), Gaps = 2/90 (2%)
 Frame = +2

Query: 65  GTLRGHNGWVT--QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           G   GH GWV+  + + NP  P  I+S S D+++ VW LT  +      + +L GH+ ++
Sbjct: 160 GAGEGHTGWVSCVRFSPNPMAPT-IVSGSWDRSVKVWNLTNCKL-----RTKLEGHNGYV 213

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           + V +S DG+   SG  D T  LWDL  GK
Sbjct: 214 NAVAVSPDGSLCASGGKDGTTLLWDLTEGK 243



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 26/87 (29%), Positives = 43/87 (49%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KLR  L GHNG+V  +A +P    +  S  +D T ++W LT  +  Y +    +  HS  
Sbjct: 201 KLRTKLEGHNGYVNAVAVSPD-GSLCASGGKDGTTLLWDLTEGKMLYKLDAGAII-HS-- 256

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
               +  S   Y L  + + ++++WDL
Sbjct: 257 ----LCFSPNRYWLCAATEDSVKIWDL 279



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH--FISDVVLSSD--GNYALSGSWDKT 298
           I+S++RD T+ +W  T  E  Y I      G  H  ++S V  S +      +SGSWD++
Sbjct: 133 IVSAARDNTIKLWN-TLGECKYTIGGDHGAGEGHTGWVSCVRFSPNPMAPTIVSGSWDRS 191

Query: 299 LRLWDLAAGKTTRRFEDH 352
           +++W+L   K   + E H
Sbjct: 192 VKVWNLTNCKLRTKLEGH 209



 Score = 35.5 bits (78), Expect = 0.035
 Identities = 23/81 (28%), Positives = 36/81 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +V  +  +       LS S D  L +W L       G   +R  GH+  +  V 
Sbjct: 72  LTGHSHFVQDVVLSSD-GQFALSGSWDGELRLWDLAT-----GRTTRRFVGHTKDVLSVA 125

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            S D    +S + D T++LW+
Sbjct: 126 FSVDNRQIVSAARDNTIKLWN 146


>01_06_0303 + 28324155-28325045,28326208-28326321
          Length = 334

 Score =  124 bits (300), Expect = 4e-29
 Identities = 64/113 (56%), Positives = 74/113 (65%), Gaps = 9/113 (7%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN---------YG 199
           E+L L G + GHN  VT IAT       I+SSSRDK+L+VW LT    N         YG
Sbjct: 6   ESLVLAGVMHGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPVQNVGEGAGASEYG 65

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +P +RL GHSHF+ DVVLSSDG +ALSGSWD  LRLWDL+ G TTRRF  H K
Sbjct: 66  VPFRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRFVGHDK 118



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 33/85 (38%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPK-YPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           GHNGWV+ +  +P  +   I+S S D+T+ VW LT  +         L GH  +++ V +
Sbjct: 163 GHNGWVSCVRFSPNTFQPTIVSGSWDRTVKVWNLTNCKLRCN-----LEGHGGYVNAVAV 217

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGK 328
           S DG+   SG  D    LWDLA GK
Sbjct: 218 SPDGSLCASGGKDGVTLLWDLAEGK 242



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 24/81 (29%), Positives = 38/81 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +V  +  +       LS S D  L +W L+      G+  +R  GH   +  V 
Sbjct: 71  LTGHSHFVQDVVLSSD-GQFALSGSWDGELRLWDLST-----GVTTRRFVGHDKDVLSVA 124

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            S D    +S S D+T++LW+
Sbjct: 125 FSVDNRQIVSASRDRTIKLWN 145



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH--FISDVVLSSDGNYA--LSGSWDKT 298
           I+S+SRD+T+ +W  T  E  Y I      G  H  ++S V  S +      +SGSWD+T
Sbjct: 132 IVSASRDRTIKLWN-TLGECKYTIGGDLGGGEGHNGWVSCVRFSPNTFQPTIVSGSWDRT 190

Query: 299 LRLWDLAAGKTTRRFEDH 352
           +++W+L   K     E H
Sbjct: 191 VKVWNLTNCKLRCNLEGH 208



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KLR  L GH G+V  +A +P    +  S  +D   ++W L   +  Y +    +  HS  
Sbjct: 200 KLRCNLEGHGGYVNAVAVSPD-GSLCASGGKDGVTLLWDLAEGKRLYSLDAGSII-HS-- 255

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
               +  S   Y L  +   ++++WDL
Sbjct: 256 ----LCFSPNRYWLCAATQDSIKIWDL 278


>06_03_0967 - 26395537-26396590,26400918-26401111
          Length = 415

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 32/95 (33%), Positives = 51/95 (53%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  +  NP    +I S S DK + +W +  D  NY +    L GH + + D+ 
Sbjct: 121 LTGHQSAVYCMKFNPA-GTVIASGSHDKDIFLWYVHGDCKNYMV----LRGHKNAVLDLQ 175

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++DG   +S S DKT+R+WD+  GK  ++  +H+
Sbjct: 176 WTTDGTQIISASPDKTVRVWDVETGKQVKKMAEHS 210



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 20/64 (31%), Positives = 33/64 (51%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D + +   D  +  W L ++E       + L GH   I+ + LS DG+Y L+ + D  L+
Sbjct: 265 DKVFTGGLDNDVKWWDLRKNEVT-----EYLKGHQDMITGMQLSPDGSYLLTNAMDNELK 319

Query: 305 LWDL 316
           +WDL
Sbjct: 320 IWDL 323



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 25/102 (24%), Positives = 43/102 (42%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K    +  H+ +V       K+P +++S S D T  +W L +      +P K     
Sbjct: 198 ETGKQVKKMAEHSSFVNSCCPARKWPPLVVSGSDDGTAKLWDLRQRGAIQTLPDK----- 252

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + I+ V  S   +   +G  D  ++ WDL   + T   + H
Sbjct: 253 -YQITAVSFSEAADKVFTGGLDNDVKWWDLRKNEVTEYLKGH 293


>11_06_0263 +
           21777178-21777342,21777742-21777823,21777939-21778028,
           21778447-21778604,21778852-21778873,21779048-21779175,
           21779486-21779685,21780600-21780663,21781594-21781704,
           21781804-21781941,21782306-21782448,21782521-21782575,
           21782921-21782977,21783093-21783176
          Length = 498

 Score = 54.0 bits (124), Expect(2) = 1e-09
 Identities = 25/77 (32%), Positives = 42/77 (54%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           P+ ++S S D T+ +W+ T  +     P+ R+ GH   ++ V  S DG +  S S+DK++
Sbjct: 354 PERLVSGSDDFTMFLWEPTISKQ----PKARMTGHQKLVNHVYFSPDGQWLASASFDKSV 409

Query: 302 RLWDLAAGKTTRRFEDH 352
           +LW+   GK    F  H
Sbjct: 410 KLWNGITGKFVAAFRGH 426



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 29/87 (33%), Positives = 41/87 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K     RGH   V QI+ +     ++LS S+D TL VW +   +    +P     GH+
Sbjct: 416 TGKFVAAFRGHVADVYQISWSAD-SRLLLSGSKDSTLKVWDIRTHKLKQDLP-----GHA 469

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  V  S DG    SG  D+ L+LW
Sbjct: 470 DEVYAVDWSPDGEKVASGGKDRVLKLW 496



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 5/107 (4%)
 Frame = +2

Query: 47  ETLKLRGT-LRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQK 211
           +T K  GT L GH  W+T ++  P +        +S+S+D    +W +T  +        
Sbjct: 205 KTGKQLGTPLTGHRKWITAVSWEPVHLQAPCRRFVSASKDGDARIWDITTRKCVIA---- 260

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            L GH++ ++ V    DG    +GS D  +++W+ + GK  +  + H
Sbjct: 261 -LTGHTNSVTCVKWGGDG-LIYTGSEDCLIKVWETSQGKLVKTLQGH 305



 Score = 35.9 bits (79), Expect = 0.026
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 3/100 (3%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK---RLYGHSH 232
           +  + GH   V  +  +P     + S+S DK++ +W         GI  K      GH  
Sbjct: 378 KARMTGHQKLVNHVYFSPD-GQWLASASFDKSVKLWN--------GITGKFVAAFRGHVA 428

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  +  S+D    LSGS D TL++WD+   K  +    H
Sbjct: 429 DVYQISWSADSRLLLSGSKDSTLKVWDIRTHKLKQDLPGH 468



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  +  V  S DG    SGS D T+R WDL
Sbjct: 113 GHTEAVLAVSFSPDGRCLASGSGDTTVRFWDL 144



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 5/97 (5%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV--- 250
           H  WV  IA +P   + ++S S+   LI+W   +     G P   L GH  +I+ V    
Sbjct: 174 HKNWVLCIAWSPD-GNHLVSGSKSGELILWD-PKTGKQLGTP---LTGHRKWITAVSWEP 228

Query: 251 --LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             L +     +S S D   R+WD+   K       HT
Sbjct: 229 VHLQAPCRRFVSASKDGDARIWDITTRKCVIALTGHT 265



 Score = 31.1 bits (67), Expect = 0.75
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   VT +        +I + S D  + VW     E + G   K L GH H+++ + 
Sbjct: 261 LTGHTNSVTCVKWGGD--GLIYTGSEDCLIKVW-----ETSQGKLVKTLQGHGHWVNSLA 313

Query: 251 LSSDGNYAL-SGSWDKTLRLWDLA 319
           LS++  Y L +G++D T + +  A
Sbjct: 314 LSTE--YILRTGAYDHTGKTYSTA 335



 Score = 25.8 bits (54), Expect(2) = 1e-09
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKY 121
           KL  TL+GH  WV  +A + +Y
Sbjct: 297 KLVKTLQGHGHWVNSLALSTEY 318


>03_05_0969 +
           29283905-29284570,29284862-29284930,29286533-29286631,
           29287016-29287324
          Length = 380

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 33/89 (37%), Positives = 46/89 (51%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR TL GH   V+ +  +P    ++ S+S DK L VW  +    +   P   L GH   +
Sbjct: 11  LRATLAGHRRAVSAVKFSPD-GRLLASASADKLLRVWSTS----DLASPVAELAGHGEGV 65

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           SD+  S DG    S S D+T+R+WDL  G
Sbjct: 66  SDLAFSPDGRLIASASDDRTVRIWDLGDG 94



 Score = 54.0 bits (124), Expect = 9e-08
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 4/100 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY----GHSHFI 238
           L GH   V+ +A +P    +I S+S D+T+ +W L       G  + RL     GH+++ 
Sbjct: 58  LAGHGEGVSDLAFSPD-GRLIASASDDRTVRIWDLGDGGGGGGGGEPRLMKTLSGHTNYA 116

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             +  S  GN   SGS+D+T+R+W++ +G+  R    H++
Sbjct: 117 FCLAFSPHGNMLASGSFDETVRVWEVRSGRCLRVLPAHSE 156



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 31/98 (31%), Positives = 50/98 (51%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL GH  +   +A +P + +M+ S S D+T+ VW++       G   + L  HS  
Sbjct: 104 RLMKTLSGHTNYAFCLAFSP-HGNMLASGSFDETVRVWEVRS-----GRCLRVLPAHSEP 157

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           ++ V  + DG   +SGS+D   R+WD A G   +   D
Sbjct: 158 VTSVDFNRDGAMIVSGSYDGLCRIWDSATGHCIKTLID 195



 Score = 35.9 bits (79), Expect = 0.026
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +2

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++G Y +SGS DK + +WDL + K  ++ E HT
Sbjct: 309 TNGKYIVSGSEDKCVYIWDLQSRKILQKLEGHT 341


>03_02_1033 +
           13550955-13551700,13552837-13553290,13553451-13553648,
           13553726-13553807,13554496-13554590
          Length = 524

 Score = 54.8 bits (126), Expect = 5e-08
 Identities = 37/118 (31%), Positives = 57/118 (48%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           S  S + K +S M +  K+  TL+GH    T +A +P   D + ++S DKT  +WK    
Sbjct: 249 SSWSGMIKVWS-MPQVTKI-ATLKGHTERATDVAFSP-VDDCLATASADKTAKLWKTD-- 303

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
               G       GH   ++ +     G Y  + S+DKT RLWD++ GK     E H++
Sbjct: 304 ----GSLLLSFDGHLDRLARLAFHPSGGYLATASFDKTWRLWDVSTGKELLLQEGHSR 357



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 20/87 (22%), Positives = 41/87 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T ++  ++  H   ++ +   P+    + +SS D    +W   RD      P K L  H 
Sbjct: 429 TKRMLYSIPAHKSLISHVKFEPQEGYYLATSSYDTKAALWS-ARDYK----PIKSLVAHE 483

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             ++ + +S DG   ++ S D+T+++W
Sbjct: 484 SKVTSLDISGDGQQIVTVSHDRTIKIW 510



 Score = 35.5 bits (78), Expect = 0.035
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   + ++A +P     + ++S DKT  +W ++  +    + Q+   GHS  +  V   
Sbjct: 312 GHLDRLARLAFHPS-GGYLATASFDKTWRLWDVSTGKEL--LLQE---GHSRSVYGVSFH 365

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            DG+ A S   D   R+WDL +G+       H K
Sbjct: 366 PDGSLAASCGLDAYARVWDLRSGRLWGTLMGHVK 399



 Score = 28.3 bits (60), Expect = 5.3
 Identities = 24/80 (30%), Positives = 34/80 (42%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+  V  ++ +P    +  S   D    VW L R    +G     L GH   +  V  S
Sbjct: 354 GHSRSVYGVSFHPD-GSLAASCGLDAYARVWDL-RSGRLWGT----LMGHVKPVLGVSFS 407

Query: 257 SDGNYALSGSWDKTLRLWDL 316
            +G    +GS D   R+WDL
Sbjct: 408 PNGYLVATGSEDNFCRIWDL 427


>03_02_1031 +
           13541327-13542072,13543209-13543662,13543823-13544020,
           13544098-13544179,13544868-13544962
          Length = 524

 Score = 54.8 bits (126), Expect = 5e-08
 Identities = 37/118 (31%), Positives = 57/118 (48%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           S  S + K +S M +  K+  TL+GH    T +A +P   D + ++S DKT  +WK    
Sbjct: 249 SSWSGMIKVWS-MPQVTKI-ATLKGHTERATDVAFSP-VDDCLATASADKTAKLWKTD-- 303

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
               G       GH   ++ +     G Y  + S+DKT RLWD++ GK     E H++
Sbjct: 304 ----GSLLLSFDGHLDRLARLAFHPSGGYLATASFDKTWRLWDVSTGKELLLQEGHSR 357



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 20/87 (22%), Positives = 41/87 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T ++  ++  H   ++ +   P+    + +SS D    +W   RD      P K L  H 
Sbjct: 429 TKRMLYSIPAHKSLISHVKFEPQEGYYLATSSYDTKAALWS-ARDYK----PIKSLVAHE 483

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             ++ + +S DG   ++ S D+T+++W
Sbjct: 484 SKVTSLDISGDGQQIVTVSHDRTIKIW 510



 Score = 35.5 bits (78), Expect = 0.035
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   + ++A +P     + ++S DKT  +W ++  +    + Q+   GHS  +  V   
Sbjct: 312 GHLDRLARLAFHPS-GGYLATASFDKTWRLWDVSTGKEL--LLQE---GHSRSVYGVSFH 365

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            DG+ A S   D   R+WDL +G+       H K
Sbjct: 366 PDGSLAASCGLDAYARVWDLRSGRLWGTLMGHVK 399



 Score = 28.3 bits (60), Expect = 5.3
 Identities = 24/80 (30%), Positives = 34/80 (42%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+  V  ++ +P    +  S   D    VW L R    +G     L GH   +  V  S
Sbjct: 354 GHSRSVYGVSFHPD-GSLAASCGLDAYARVWDL-RSGRLWGT----LMGHVKPVLGVSFS 407

Query: 257 SDGNYALSGSWDKTLRLWDL 316
            +G    +GS D   R+WDL
Sbjct: 408 PNGYLVATGSEDNFCRIWDL 427


>10_01_0025 -
           328105-328188,328281-328337,328680-328734,328809-328951,
           330772-330909,331010-331120,332621-332684,334179-334378,
           334678-334805,335468-335593,335828-335917,336035-336116,
           336845-336910
          Length = 447

 Score = 54.0 bits (124), Expect = 9e-08
 Identities = 25/77 (32%), Positives = 42/77 (54%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           P+ ++S S D T+ +W+ T  +     P+ R+ GH   ++ V  S DG +  S S+DK++
Sbjct: 303 PERLVSGSDDFTMFLWEPTISKQ----PKARMTGHQKLVNHVYFSPDGQWLASASFDKSV 358

Query: 302 RLWDLAAGKTTRRFEDH 352
           +LW+   GK    F  H
Sbjct: 359 KLWNGITGKFVAAFRGH 375



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 29/87 (33%), Positives = 41/87 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K     RGH   V QI+ +     ++LS S+D TL VW +   +    +P     GH+
Sbjct: 365 TGKFVAAFRGHVADVYQISWSAD-SRLLLSGSKDSTLKVWDIRTRKLKQDLP-----GHA 418

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  V  S DG    SG  D+ L+LW
Sbjct: 419 DEVYAVDWSPDGEKVASGGKDRVLKLW 445



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 27/87 (31%), Positives = 40/87 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH   V  ++ +P     + S S D T+  W L+        P     GH +++  +
Sbjct: 77  TIAGHTEAVLAVSFSPD-GRCLASGSGDTTVRFWDLSTQT-----PLFTCKGHKNWVLCI 130

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
             S DGN+ +SGS    L LWD   GK
Sbjct: 131 AWSPDGNHLVSGSKSGELILWDPKTGK 157



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 5/107 (4%)
 Frame = +2

Query: 47  ETLKLRGT-LRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQK 211
           +T K  GT L GH  W+T ++  P +        +S+S+D    +W +T  +        
Sbjct: 154 KTGKQLGTPLTGHRKWITAVSWEPVHLQSPCRRFVSTSKDGDARIWDMTTRKCVIA---- 209

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            L GH++ ++ V    DG    +GS D ++++W+ + GK  +  + H
Sbjct: 210 -LTGHTNSVTCVKWGGDG-LIYTGSEDCSIKVWETSQGKLVKTLQGH 254



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 5/101 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH  WV  IA +P   + ++S S+   LI+W   +     G P   L GH  +I+ V
Sbjct: 119 TCKGHKNWVLCIAWSPD-GNHLVSGSKSGELILWD-PKTGKQLGTP---LTGHRKWITAV 173

Query: 248 V-----LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                 L S     +S S D   R+WD+   K       HT
Sbjct: 174 SWEPVHLQSPCRRFVSTSKDGDARIWDMTTRKCVIALTGHT 214



 Score = 35.9 bits (79), Expect = 0.026
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 3/100 (3%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK---RLYGHSH 232
           +  + GH   V  +  +P     + S+S DK++ +W         GI  K      GH  
Sbjct: 327 KARMTGHQKLVNHVYFSPD-GQWLASASFDKSVKLWN--------GITGKFVAAFRGHVA 377

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  +  S+D    LSGS D TL++WD+   K  +    H
Sbjct: 378 DVYQISWSADSRLLLSGSKDSTLKVWDIRTRKLKQDLPGH 417



 Score = 32.3 bits (70), Expect = 0.32
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 1/84 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   VT +        +I + S D ++ VW     E + G   K L GH H+++ + 
Sbjct: 210 LTGHTNSVTCVKWGGD--GLIYTGSEDCSIKVW-----ETSQGKLVKTLQGHGHWVNSLA 262

Query: 251 LSSDGNYAL-SGSWDKTLRLWDLA 319
           LS++  Y L +G++D T + +  A
Sbjct: 263 LSTE--YVLRTGAYDHTGKTYSTA 284


>02_02_0017 -
           6131265-6131284,6131654-6131774,6132011-6132146,
           6132423-6132529,6133006-6133099,6133199-6133395,
           6134401-6134472,6135128-6135304,6135393-6135467,
           6135557-6135697,6136439-6136627,6136969-6137034,
           6137118-6137268,6137596-6137664,6138751-6138899,
           6138969-6139100,6139198-6139523,6139599-6139635,
           6139765-6139803,6140196-6140250,6140363-6140424,
           6140512-6140532,6140820-6140822
          Length = 812

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH+ +V Q+  NPK  +   S+S D+T+ VW L   + N+      L GHS  ++  D  
Sbjct: 153 GHSHYVMQVTFNPKDTNTFASASLDRTVKVWSLGSPDPNF-----TLDGHSKGVNCVDYF 207

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              D  Y ++GS D+T ++WD       +  E H
Sbjct: 208 TGGDRPYLITGSDDQTAKVWDYQTKSCVQTLEGH 241



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 1/94 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H  ++  +A +P  P  +LSSS D  + +W    D +   +  +   GHSH++  V  + 
Sbjct: 111 HTDYIRCVAVHPTQP-FVLSSSDDMLIKLW----DWDKGWMCTQIFEGHSHYVMQVTFNP 165

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            D N   S S D+T+++W L +       + H+K
Sbjct: 166 KDTNTFASASLDRTVKVWSLGSPDPNFTLDGHSK 199



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 33/96 (34%), Positives = 43/96 (44%), Gaps = 2/96 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+  V  +   T    P +I  S  D+T  VW    D       Q  L GH+H +S
Sbjct: 193 TLDGHSKGVNCVDYFTGGDRPYLITGSD-DQTAKVW----DYQTKSCVQT-LEGHAHNVS 246

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            V    +    L+GS D T+RLW      TT R E+
Sbjct: 247 AVCFHPELPITLTGSEDGTVRLWH----STTYRLEN 278


>03_05_0621 -
           26198985-26199020,26199539-26199652,26200260-26200623,
           26201232-26201527
          Length = 269

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 2/96 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH-SHFISDV 247
           L GH G+V+     P     +++SS D+T ++W +T  +       +   GH +  +S  
Sbjct: 42  LTGHKGYVSSCQYVPDQETRLITSSGDQTCVLWDVTTGQRISIFGGEFPSGHTADVLSLS 101

Query: 248 VLSSDGNYALSGSWDKTLRLWDL-AAGKTTRRFEDH 352
           + SS+ N  +SGS D T+RLWD+  A +  R +  H
Sbjct: 102 INSSNSNMFVSGSCDATVRLWDIRIASRAVRTYHGH 137



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 24/83 (28%), Positives = 37/83 (44%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  ++ N    +M +S S D T+ +W +           +  +GH   I+ V   
Sbjct: 92  GHTADVLSLSINSSNSNMFVSGSCDATVRLWDIRIASRAV----RTYHGHEGDINSVKFF 147

Query: 257 SDGNYALSGSWDKTLRLWDLAAG 325
            DG    +GS D T RL+D+  G
Sbjct: 148 PDGQRFGTGSDDGTCRLFDVRTG 170



 Score = 35.9 bits (79), Expect = 0.026
 Identities = 15/29 (51%), Positives = 20/29 (68%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           H   IS + LSSDG+   +GSWDK L++W
Sbjct: 232 HEGRISCLGLSSDGSALCTGSWDKNLKIW 260


>06_01_0320 -
           2320317-2320336,2320791-2320902,2321092-2321236,
           2321353-2321459,2321572-2321665,2321752-2321948,
           2322311-2322382,2322504-2322618,2323060-2323176,
           2323253-2323344,2323445-2323621,2323746-2323820,
           2323911-2324051,2324671-2324859,2325298-2325363,
           2325445-2325595,2325718-2325786,2326293-2326441,
           2326526-2326657,2326756-2327081,2327167-2327203,
           2327926-2327980,2328242-2328309,2328464-2328466
          Length = 902

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH+ +V Q+  NPK  +   S+S D+T  +W L   + N+      L GH   ++  D  
Sbjct: 135 GHSHYVMQVTFNPKDTNTFASASLDRTTKIWSLGSPDPNF-----TLDGHQKGVNCVDYF 189

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              D  Y ++GS D T ++WD       +  E HT
Sbjct: 190 TGGDRPYLITGSDDSTAKVWDYQTKSCVQTLEGHT 224



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H  ++  +A +P  P  +LSSS D  + +W    D +   +  +   GHSH++  V  + 
Sbjct: 93  HTDYIRCVAVHPTLP-YVLSSSDDMLIKLW----DWDKGWMCTQIFEGHSHYVMQVTFNP 147

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            D N   S S D+T ++W L +       + H K
Sbjct: 148 KDTNTFASASLDRTTKIWSLGSPDPNFTLDGHQK 181



 Score = 31.1 bits (67), Expect = 0.75
 Identities = 32/96 (33%), Positives = 41/96 (42%), Gaps = 2/96 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH   V  +   T    P +I  S  D T  VW    D       Q  L GH+H IS
Sbjct: 175 TLDGHQKGVNCVDYFTGGDRPYLITGSD-DSTAKVW----DYQTKSCVQT-LEGHTHNIS 228

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            V    +    ++GS D T+R+W      TT R E+
Sbjct: 229 AVCFHPELPIIITGSEDGTVRIWH----STTYRLEN 260


>03_03_0256 + 15898702-15900420
          Length = 572

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 26/89 (29%), Positives = 42/89 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V+ I   PKY  ++LS+S D  + +W +           +   GHS  + D+  S
Sbjct: 280 GHTKGVSAIRFFPKYGHLLLSASMDCKIKIWDVLESRTC----MRTYMGHSKAVRDISFS 335

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           +DG   LS  +D+ ++ WD   G+    F
Sbjct: 336 NDGTKFLSAGYDRNIQYWDTETGQVISTF 364



 Score = 27.9 bits (59), Expect = 7.0
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH--SHFISDVVL 253
           H   +  I+ +P   + + + S D  ++++  T++       +KR  GH  + +   V  
Sbjct: 454 HMHSMPSISLHPN-SNWLAAQSLDNQILIYS-TKERFQLN-KKKRFAGHIVAGYACQVNF 510

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           S DG + +SG  + +   WD    K+ RRF+
Sbjct: 511 SPDGRFVMSGDGEGSCWFWD---WKSCRRFK 538


>04_04_0990 -
           29955207-29955551,29955639-29955813,29955887-29956017,
           29956317-29956436,29956908-29956984,29957070-29957316,
           29957413-29957569,29958191-29958309,29958421-29958555,
           29958636-29958921,29959009-29959211,29959732-29959881,
           29960084-29960266,29960931-29961278
          Length = 891

 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 28/101 (27%), Positives = 48/101 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK +  +  H+  +  ++ +P    ++ S S D+T  +WKL        +P   L GH  
Sbjct: 497 LKAKAVVAAHDKDINSLSVSPN-DGLVCSGSEDRTACIWKLPNL-----VPSVVLKGHKR 550

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            I  V  S      ++ S D+T+++W +A G   + FE HT
Sbjct: 551 GIWSVEFSPVEQCVITSSGDRTVKIWAVADGSCLKTFEGHT 591



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 5/89 (5%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL--TRDENNYGIPQKR---LYGHS 229
           G  +GH G +  +A + K  +  +S S D+T+ +W    T D+    +P K    +  H 
Sbjct: 448 GIGKGHLGAIGSVAFSKKSKNFFVSGSSDRTIKIWSWDDTLDDVGSEVPLKAKAVVAAHD 507

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDL 316
             I+ + +S +     SGS D+T  +W L
Sbjct: 508 KDINSLSVSPNDGLVCSGSEDRTACIWKL 536



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMIL-SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           RGH G VT +  +     ++L S S D T+ VW L   E+   +    L  H   ++ + 
Sbjct: 158 RGHAGVVTTVMFHKDPKRLLLFSGSEDATVRVWNL---ESKKCVAV--LKEHFSAVTSLA 212

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
           LS DG   LS   DK + +WD+
Sbjct: 213 LSEDGQTLLSAGRDKIVNVWDV 234



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 29/118 (24%), Positives = 55/118 (46%), Gaps = 2/118 (1%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           +G S L + +   S T     + +GH+G +  +A +     ++ ++  DK + VW +   
Sbjct: 95  AGHSRLIRVWDLASRTCTR--SWKGHDGPIRAMACHAS-GGLLATAGADKKVCVWDV--- 148

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDH 352
             + G       GH+  ++ V+   D    L  SGS D T+R+W+L + K     ++H
Sbjct: 149 --DGGFCTHFFRGHAGVVTTVMFHKDPKRLLLFSGSEDATVRVWNLESKKCVAVLKEH 204



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 21/94 (22%), Positives = 40/94 (42%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   +  +  +P     +++SS D+T+ +W +       G   K   GH+  +    
Sbjct: 545 LKGHKRGIWSVEFSP-VEQCVITSSGDRTVKIWAVAD-----GSCLKTFEGHTSSVLRAS 598

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S G   +S   D  ++LW +   +    F+ H
Sbjct: 599 FLSHGTQFVSCGSDGLVKLWTIKTNECIATFDKH 632



 Score = 31.1 bits (67), Expect = 0.75
 Identities = 12/44 (27%), Positives = 23/44 (52%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           G +  ++ + LS D     +    + +R+WDLA+   TR ++ H
Sbjct: 75  GENEAVTALALSPDSRLLFTAGHSRLIRVWDLASRTCTRSWKGH 118



 Score = 29.9 bits (64), Expect = 1.7
 Identities = 22/97 (22%), Positives = 38/97 (39%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + G N  VT +A +P    ++ ++   + + VW L           +   GH   I  + 
Sbjct: 73  IEGENEAVTALALSPD-SRLLFTAGHSRLIRVWDLASRTCT-----RSWKGHDGPIRAMA 126

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             + G    +   DK + +WD+  G  T  F  H  V
Sbjct: 127 CHASGGLLATAGADKKVCVWDVDGGFCTHFFRGHAGV 163


>03_02_0939 +
           12571052-12571173,12571219-12571309,12571413-12571512,
           12571726-12571807,12571897-12571953,12572632-12572713,
           12572792-12572884,12573984-12574047,12574161-12574246,
           12574329-12574430,12574526-12574609,12574885-12574945,
           12575010-12575091,12575173-12575250,12575867-12575931,
           12576108-12576185,12576278-12576450
          Length = 499

 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 29/94 (30%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH GWV  IA +P   +   + S D+T+ +W L       G  +  L GH   I  + 
Sbjct: 180 ISGHLGWVRSIAFDPSN-EWFCTGSADRTIKIWDLAS-----GTLKLTLTGHIEQIRGLA 233

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S    Y  S   DK ++ WDL   K  R +  H
Sbjct: 234 VSQRHTYLFSAGDDKQVKCWDLEQNKVIRSYHGH 267



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 25/92 (27%), Positives = 40/92 (43%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  +  GH   V  +A +P   D++L+  RD    VW +    +        L GH
Sbjct: 256 EQNKVIRSYHGHLSGVYCLALHPTI-DILLTGGRDSVCRVWDIRTKAH-----VSALTGH 309

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
            + +  V         ++GS D T++ WDL A
Sbjct: 310 DNTVCSVFARPTDPQVVTGSHDSTIKFWDLVA 341


>04_04_1592 -
           34649484-34649547,34650118-34650186,34650325-34650444,
           34650630-34650742,34650824-34650898,34651224-34651346,
           34651427-34651446,34652354-34652410,34652922-34653860,
           34653961-34654189,34654296-34654439,34654527-34654601,
           34655363-34655433,34656103-34656205,34656407-34656633,
           34656791-34656908,34657239-34657369,34657709-34657802
          Length = 923

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 29/102 (28%), Positives = 47/102 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL GH      +  +P + +   S S D  L +W + R    +        GH
Sbjct: 111 EEAKIVRTLTGHRSNCMSVDFHP-FGEFFASGSLDTNLKIWDIRRKGCIHTYK-----GH 164

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  ++ +  + DG + +SG  D  ++LWDL AGK    F+ H
Sbjct: 165 TRGVNAIRFTPDGRWVVSGGEDNVVKLWDLTAGKLLHDFKCH 206



 Score = 31.1 bits (67), Expect = 0.75
 Identities = 14/46 (30%), Positives = 21/46 (45%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH+  +  V   S   +  +G+   T++LWDL   K  R    H
Sbjct: 77  LSGHTSAVESVNFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGH 122



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           + L GH      V     G +  SGS D  L++WD+        ++ HT+
Sbjct: 117 RTLTGHRSNCMSVDFHPFGEFFASGSLDTNLKIWDIRRKGCIHTYKGHTR 166


>02_02_0528 +
           11199799-11200470,11201850-11201951,11202858-11203487,
           11204287-11204547
          Length = 554

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +2

Query: 71  LRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           LR H    W  Q + N KY   + S+S DK+ I+WK+  DE+   + +  L GH   +  
Sbjct: 226 LRAHRDEVWFLQFSNNGKY---LASASNDKSAIIWKV--DEDGELLLKHTLTGHDKPVMM 280

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           V  S D    L+   ++ +R WD+ +GK    +E
Sbjct: 281 VAWSPDDCQLLTCGMEEVIRCWDVESGKCLHVYE 314



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           TL GH G V  ++ NP  P M+ S+S D T+ +W L +
Sbjct: 482 TLPGHTGTVNCVSWNPANPHMLASASDDHTIRIWGLKK 519



 Score = 28.3 bits (60), Expect = 5.3
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 2/81 (2%)
 Frame = +2

Query: 119 YPD--MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           +PD   ILS   D    +W L   E +    Q+     S   SD  +S+DG   +S + +
Sbjct: 326 FPDGKHILSGLTDHNFCLWDLDGKEVDCWKGQR-----SSKTSDFAVSNDGKLIISMNRE 380

Query: 293 KTLRLWDLAAGKTTRRFEDHT 355
            T+RL+D    +     ED+T
Sbjct: 381 STIRLFDRETKQERLIEEDNT 401


>12_01_0418 -
           3304741-3304904,3305579-3305762,3307254-3307347,
           3308530-3308882,3309140-3309274,3309354-3309392,
           3309587-3309652,3309739-3309834,3310291-3310527,
           3310602-3310722,3310854-3310889,3313062-3313159,
           3313298-3313591,3313842-3313904,3314280-3314438,
           3314557-3314655
          Length = 745

 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 29/96 (30%), Positives = 46/96 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH   V  +A +    + ++S   +K + VW     +   G  + +L GH+  I  +
Sbjct: 178 TAKGHKDSVYALAMSDT-GNTLVSGGTEKVVRVW-----DPRTGSKKMKLRGHTDNIRAL 231

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +L   G Y LSGS D  +RLWDL   +    +  HT
Sbjct: 232 LLDPTGRYCLSGSSDSMIRLWDLGQQRCIHSYAVHT 267


>01_06_0923 +
           33044283-33044433,33044826-33045242,33046209-33046538,
           33046806-33046876,33047283-33047357,33047435-33047578,
           33047645-33047816,33047933-33048616,33048711-33048767,
           33048850-33048956,33049485-33049610,33050221-33050295,
           33050387-33050499,33050789-33050905,33051384-33051444,
           33051690-33051763,33052267-33052388,33052472-33052620,
           33053525-33053635,33053946-33054008,33054689-33054722,
           33055253-33055375,33055971-33056033,33056130-33056196,
           33056311-33056356,33056446-33056552,33056923-33056971,
           33057208-33057273,33057544-33057630
          Length = 1286

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 27/103 (26%), Positives = 47/103 (45%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  +L GH    T +  +P + +   S S D  L +W + +    +        GH
Sbjct: 186 EEAKVVRSLTGHRSSCTSVEFHP-FGEFFASGSSDTDLKIWDIKKKGCIHTYK-----GH 239

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              I  +  + DG + ++G  D  +++WDL AGK    F+ H+
Sbjct: 240 RGAIRTIRFTPDGRWVVTGGEDNIVKVWDLTAGKLLHDFKFHS 282



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 14/46 (30%), Positives = 22/46 (47%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH+  +  V   +     L+GS + +++LWDL   K  R    H
Sbjct: 152 LSGHTGSVEAVEFDTAEVLVLAGSSNGSIKLWDLEEAKVVRSLTGH 197



 Score = 27.9 bits (59), Expect = 7.0
 Identities = 21/83 (25%), Positives = 34/83 (40%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH G +  I   P     +++   D  + VW LT  +  +         HS  I  +
Sbjct: 235 TYKGHRGAIRTIRFTPD-GRWVVTGGEDNIVKVWDLTAGKLLHDFKF-----HSGQIRCI 288

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
                     +GS D+T++ WDL
Sbjct: 289 DFHPQEFLLATGSADRTVKFWDL 311


>09_01_0139 - 2074193-2077146,2077549-2078043,2078983-2079190
          Length = 1218

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 35/126 (27%), Positives = 64/126 (50%), Gaps = 3/126 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++  +  + +YP  I+S+S D+T+ +W   +      +    L GH+H++   
Sbjct: 88  TLHGHLDYIRTVQFHHEYP-WIVSASDDQTIRIWNW-QSRTCVAV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAA--GKTTRRFEDHTKV*Q-NS*FC*GVNADYALKII 418
                 +  +S S D+T+R+WD+ A   KT    +D  ++ Q N+    GV+A   +K +
Sbjct: 142 SFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDA--VVKYV 199

Query: 419 LSAYAR 436
           L  + R
Sbjct: 200 LEGHDR 205



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 23/81 (28%), Positives = 45/81 (55%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V   + +P  P +I+S + D+ + +W++  D   + +   R  GH + +S V+
Sbjct: 200 LEGHDRGVNWASFHPTLP-LIVSGADDRQVKLWRMN-DTKAWEVDTLR--GHMNNVSCVM 255

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
             +  +  +S S DK++R+WD
Sbjct: 256 FHAKQDIIVSNSEDKSIRVWD 276



 Score = 31.9 bits (69), Expect = 0.43
 Identities = 16/38 (42%), Positives = 25/38 (65%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           TLRGH   V+ +  + K  D+I+S+S DK++ VW  T+
Sbjct: 243 TLRGHMNNVSCVMFHAKQ-DIIVSNSEDKSIRVWDATK 279


>06_03_0940 +
           26145746-26145879,26146740-26146821,26147349-26147427,
           26147527-26147624,26148392-26148479,26148589-26148686,
           26148881-26148982,26149237-26149281,26150535-26150574,
           26150988-26151074,26151254-26151330,26151746-26151808,
           26152650-26152766,26152905-26153116,26153690-26153785,
           26153869-26153935,26154028-26154081
          Length = 512

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 24/72 (33%), Positives = 38/72 (52%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S+S D+T  +W + + +     P + + GH   +  V    + NY  +GS DKT+RLWD+
Sbjct: 341 SASHDRTARIWSMDKIQ-----PLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDV 395

Query: 317 AAGKTTRRFEDH 352
             G+  R F  H
Sbjct: 396 QTGECIRMFIGH 407



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 21/66 (31%), Positives = 34/66 (51%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I + S DKT+ +W +   E       +   GH   +  + +S DG Y  SG  D T+ +W
Sbjct: 381 IATGSSDKTVRLWDVQTGECI-----RMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMW 435

Query: 311 DLAAGK 328
           DL++G+
Sbjct: 436 DLSSGR 441


>03_05_0886 - 28516210-28519163,28519577-28520071,28520757-28520964
          Length = 1218

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 35/126 (27%), Positives = 64/126 (50%), Gaps = 3/126 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++  +  + +YP  I+S+S D+T+ +W   +      +    L GH+H++   
Sbjct: 88  TLHGHLDYIRTVQFHHEYP-WIVSASDDQTIRIWNW-QSRTCVAV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAA--GKTTRRFEDHTKV*Q-NS*FC*GVNADYALKII 418
                 +  +S S D+T+R+WD+ A   KT    +D  ++ Q N+    GV+A   +K +
Sbjct: 142 SFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILRLTQMNTDLFGGVDA--VVKYV 199

Query: 419 LSAYAR 436
           L  + R
Sbjct: 200 LEGHDR 205



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/81 (28%), Positives = 45/81 (55%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V   + +P  P +I+S + D+ + +W++  D   + +   R  GH + +S V+
Sbjct: 200 LEGHDRGVNWASFHPTLP-LIVSGADDRQVKLWRMN-DTKAWEVDTLR--GHMNNVSCVM 255

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
             +  +  +S S DK++R+WD
Sbjct: 256 FHAKQDIIVSNSEDKSIRIWD 276



 Score = 31.5 bits (68), Expect = 0.57
 Identities = 15/38 (39%), Positives = 25/38 (65%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           TLRGH   V+ +  + K  D+I+S+S DK++ +W  T+
Sbjct: 243 TLRGHMNNVSCVMFHAKQ-DIIVSNSEDKSIRIWDATK 279


>09_06_0328 +
           22365308-22365415,22365743-22366018,22366166-22366417,
           22366542-22366939,22367028-22368021,22368199-22368409,
           22368515-22368749,22368874-22368996,22369190-22369310,
           22369416-22369625
          Length = 975

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 31/102 (30%), Positives = 44/102 (43%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TLRGH   V  +  +P     + S S D T+ +W +       GI    L GH
Sbjct: 113 ENWKVVMTLRGHTADVVDLNWSPD-DSTLASGSLDNTVHIWSMAN-----GICTAVLRGH 166

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           S  +  V     G++  S S DKT+ +W  +      R E H
Sbjct: 167 SSLVKGVTWDPIGSFIASQSDDKTVIIWRTSDWSLAHRTEGH 208



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           L GH+  + D+  S D +   SGS D T+ +W +A G  T     H+ +
Sbjct: 121 LRGHTADVVDLNWSPDDSTLASGSLDNTVHIWSMANGICTAVLRGHSSL 169


>02_02_0241 - 8204430-8205398
          Length = 322

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RGH   V   A + ++PD+  S+S D+T  VW +        IP      H H +  +
Sbjct: 149 TFRGHEYCVYAAAWSARHPDVFASASGDRTARVWDVREPAPTLVIP-----AHDHEVLSL 203

Query: 248 VLSS-DGNYALSGSWDKTLRLWDLAA 322
                D +   +GS DK++R+WD+ A
Sbjct: 204 DWDKYDPSILATGSVDKSIRVWDVRA 229



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = +2

Query: 275 LSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LS SWD TL+LW      + R F  H
Sbjct: 128 LSASWDDTLKLWSPDRPASVRTFRGH 153


>10_08_0305 -
           16644276-16644290,16644611-16645258,16646764-16646865,
           16646980-16647111,16647574-16648242
          Length = 521

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 3/107 (2%)
 Frame = +2

Query: 32  FSKMSETLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           FS+   T+++   L GHN   W  + + +  Y   + SSS D T I+WK+  D+    + 
Sbjct: 259 FSQEGITIQI---LCGHNNEVWFVRFSNDGNY---LASSSSDCTAIIWKVEEDDT---LT 309

Query: 206 QKR-LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           +K  L GH + IS V  S +    L+    ++++LW++A G+ + +F
Sbjct: 310 KKHCLVGHKNPISFVAWSPNDRMLLTCGNGESVKLWNVATGECSLKF 356


>08_01_0255 +
           2089543-2089583,2089696-2090089,2090797-2090862,
           2091067-2091189,2091605-2091685,2091765-2091857,
           2092103-2092178,2092255-2092334,2092433-2092504,
           2092937-2092996,2093177-2093273,2093498-2093561,
           2093706-2093765,2093942-2094035
          Length = 466

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 28/106 (26%), Positives = 54/106 (50%), Gaps = 1/106 (0%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A+G + + +  +  +E  K+  +L GH G V +I + P  P +I+S+S+D+++ +W +  
Sbjct: 189 AAGSTGIIRVINCATE--KIYKSLVGHGGSVNEIKSQPSNPSLIISASKDESIKLWNV-- 244

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYA-LSGSWDKTLRLWDL 316
                 +    + GH H +  V   +   Y  LS   D T+R+W +
Sbjct: 245 QTGILILVFGGVGGHRHEVLGVDFHTSDIYRFLSCGMDNTVRIWSM 290


>08_01_0058 +
           388989-389102,389226-389337,389457-389483,389787-389859,
           389958-390061,390144-390358,390429-390528,390739-390805,
           391628-391716,391810-391948,392057-392157,392921-393088,
           393302-393510
          Length = 505

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 1/106 (0%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKR 214
           K   T     +L  H+  V  +  +P   + + S +    +I+WKL + D+      QK 
Sbjct: 49  KKLPTATYHSSLSSHSSAVNVLRFSPS-GENLASGADGGGIIIWKLHSTDDGEAWKVQKT 107

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L  H   + D+  S DG + +S S D +  +WD   G   ++ E H
Sbjct: 108 LLFHHKDVLDLQWSQDGAFLVSASVDNSCIVWDAIKGSVQQKLEGH 153



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 26/88 (29%), Positives = 43/88 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K++ TL  H+  V  +  +      ++S+S D + IVW   +     G  Q++L GH
Sbjct: 100 EAWKVQKTLLFHHKDVLDLQWSQDGA-FLVSASVDNSCIVWDAIK-----GSVQQKLEGH 153

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLW 310
            H++  V     G Y  S S D+T R++
Sbjct: 154 LHYVQGVAWDPLGQYIASLSSDRTCRIY 181


>11_01_0705 -
           5795976-5796051,5796450-5796518,5796632-5796780,
           5796875-5797006,5797128-5797450,5798166-5798172,
           5799126-5799180,5799685-5799740,5799862-5800029,
           5800912-5801097,5801269-5801419,5801515-5801743,
           5802277-5802532,5802793-5802894
          Length = 652

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 2/93 (2%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           +G   QI  NPK       +S  K   VW +    + +      L GH + +S +   + 
Sbjct: 486 HGLAYQIKFNPKDTHKFAVASL-KDAQVWNIRSSRHEF-----TLSGHGYIVSCLDYFTR 539

Query: 263 GN--YALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GN  Y ++GSWDKT ++WD       +  E HT
Sbjct: 540 GNQLYMITGSWDKTAKIWDCQRRTCVQTLEGHT 572



 Score = 29.9 bits (64), Expect = 1.7
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S DKT  +W   R         + L GH+  I+ V    D    L+GS D+T+RLW
Sbjct: 545 MITGSWDKTAKIWDCQRRTC-----VQTLEGHTDCITCVCSHPDLPILLTGSNDETVRLW 599

Query: 311 D 313
           +
Sbjct: 600 N 600


>10_08_0491 -
           18283404-18283482,18283590-18283658,18283767-18283883,
           18283953-18284068,18284149-18284223,18284248-18284430,
           18284530-18284591,18284668-18285606,18285723-18285846,
           18285917-18286060,18286151-18286225,18286359-18286382,
           18287025-18287095,18287305-18287407,18287555-18287781,
           18287910-18288027,18288220-18288311,18288793-18288874
          Length = 899

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 25/99 (25%), Positives = 45/99 (45%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+  T  GH      +  +P + +   S S D  + +W + +    +        GH+  
Sbjct: 97  KVVRTFTGHRSSCASLDFHP-FGEFFASGSSDTNMKIWDMRKKGCIHTYK-----GHTRR 150

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           I  +  + DG + +SG  D ++++WDL AGK    F +H
Sbjct: 151 IDVLRFTPDGRWIVSGGSDNSVKIWDLTAGKLLHDFRNH 189



 Score = 27.9 bits (59), Expect = 7.0
 Identities = 11/46 (23%), Positives = 21/46 (45%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GH    + +     G +  SGS D  +++WD+        ++ HT+
Sbjct: 104 GHRSSCASLDFHPFGEFFASGSSDTNMKIWDMRKKGCIHTYKGHTR 149



 Score = 27.5 bits (58), Expect = 9.2
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 7/95 (7%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPD--MILSSSRDKTLIVWKLT-----RDENNYGIPQK 211
           ++ +G +  + G   +I      PD   I+S   D ++ +W LT      D  N+  P  
Sbjct: 135 MRKKGCIHTYKGHTRRIDVLRFTPDGRWIVSGGSDNSVKIWDLTAGKLLHDFRNHEGPIN 194

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            L  H H   + +L++       GS DKT++ WDL
Sbjct: 195 CLDFHPH---EFLLAT-------GSADKTVKFWDL 219


>07_03_0971 + 23038409-23039134,23040321-23040611
          Length = 338

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 26/96 (27%), Positives = 42/96 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH  +V     NP+    + S   D T+ +W +       G   + +  HS  ++ V 
Sbjct: 128 LKGHTNFVFSANFNPQTNSTVASGGFDCTVRIWDVKS-----GRCVRAIDAHSEPVTSVH 182

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+  +SGS D T ++WD   G   +   D  K
Sbjct: 183 FIRDGSIIVSGSHDGTCKIWDAGTGSCLKTVIDEKK 218



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH+  +SD+  S+D  Y  S S D+TLR+WD+
Sbjct: 63  LRGHADGVSDISWSTDSFYLCSASDDRTLRIWDV 96



 Score = 31.5 bits (68), Expect = 0.57
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = +2

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++G Y +SGS D  + +WDL      ++ E HT
Sbjct: 273 TNGKYIVSGSEDNCVYIWDLQGKNILQKLEGHT 305


>02_02_0016 -
           6118739-6118758,6119116-6119236,6119478-6119613,
           6119887-6119993,6120316-6120409,6120509-6120705,
           6121872-6121943,6122597-6122773,6122862-6122936,
           6123027-6123167,6123837-6124025,6124415-6124480,
           6124564-6124714,6125040-6125200,6126279-6126410,
           6126508-6126833,6126906-6126942,6127056-6127088,
           6127500-6127554,6127666-6127753,6127817-6127862
          Length = 807

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 1/94 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H  ++  +A +P  P  +LSSS D  + +W    D +   +  +   GHSH++  V  + 
Sbjct: 125 HTDYIRCVAVHPTQP-FVLSSSDDMLIKLW----DWDKGWMCTQIFEGHSHYVMQVTFNP 179

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            D N   S S D+T+++W L +       + H+K
Sbjct: 180 KDTNTFASASLDRTVKVWSLGSPDPNFTLDGHSK 213



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 2/78 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH+ +V Q+  NPK  +   S+S D+T+ VW L   + N+      L GHS  ++  D  
Sbjct: 167 GHSHYVMQVTFNPKDTNTFASASLDRTVKVWSLGSPDPNF-----TLDGHSKGVNCVDYF 221

Query: 251 LSSDGNYALSGSWDKTLR 304
              D  Y ++GS D+T +
Sbjct: 222 TGGDRPYLITGSDDQTAK 239


>11_06_0627 + 25633537-25633884,25635246-25635869
          Length = 323

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 24/100 (24%), Positives = 52/100 (52%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           +K    L GH+  V  +  +P  P ++ ++S D  + ++   ++++  G     + GH+ 
Sbjct: 192 MKFLHHLEGHHMPVRSMVFSPVDPHVLFTASDDCHIHIYD-AKEKSLIGA----MSGHAS 246

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++  + +S DG    +GS D+T+RLWD+    + +   +H
Sbjct: 247 WVLSIDVSPDGMAVATGSSDRTVRLWDINTRASVQTMSNH 286



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 14/44 (31%), Positives = 18/44 (40%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           G   F+  V  S DG     GS D T+ ++D    K     E H
Sbjct: 158 GSGKFVLSVAWSPDGKLLACGSMDGTIAVYDAVRMKFLHHLEGH 201


>04_04_0835 +
           28538032-28539006,28539113-28539203,28539291-28539448,
           28539543-28539594,28539707-28539786,28539890-28539983,
           28540078-28540633,28541160-28541259,28541576-28541617,
           28542445-28542588
          Length = 763

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 29/83 (34%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           RGH+G V  ++ ++ K+   +LS+S DKT+ +W++      Y     R+Y HS+F++ V 
Sbjct: 310 RGHSGDVLDLSWSSDKH---LLSASTDKTVRMWEI-----GYA-NCIRVYPHSNFVTCVQ 360

Query: 251 LS-SDGNYALSGSWDKTLRLWDL 316
            + +D N  +SGS D  +R+WD+
Sbjct: 361 FNLADENLFISGSIDGKIRVWDI 383



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           P     GHS  + D+  SSD  + LS S DKT+R+W++      R
Sbjct: 305 PVHEFRGHSGDVLDLSWSSD-KHLLSASTDKTVRMWEIGYANCIR 348


>07_01_0174 -
           1227871-1228043,1228303-1228423,1228519-1228588,
           1228877-1228953,1229215-1229393,1229558-1229684,
           1229849-1229861,1230351-1230378,1230426-1230516,
           1230870-1230956,1231239-1231276,1231426-1231464,
           1231553-1231699,1231899-1231958,1232033-1232111,
           1232429-1232517,1232906-1232967,1233238-1233427,
           1233929-1234068,1235813-1236147,1237086-1237133
          Length = 730

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 28/81 (34%), Positives = 42/81 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T++GH   VT +A +      I+SSS D T+ VW LT      G P   + GH+  +  V
Sbjct: 102 TMKGHTSQVTGLAVDNNGD--IISSSMDCTIKVWALT------GQPLLEMIGHTSLVYSV 153

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
              S G   +SGS D++ ++W
Sbjct: 154 DAHSSG-VIVSGSEDRSAKIW 173



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 32/104 (30%), Positives = 46/104 (44%), Gaps = 5/104 (4%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L   LRGH   V  I         I +SSRD+T+  W    ++ +  +  K L GHS F+
Sbjct: 6   LSAQLRGHEDDVRGICICGDAG--IATSSRDRTVRFWTQHPEKKHEYVLSKTLVGHSSFV 63

Query: 239 SDV--VLSSD---GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +  +  SD       +SG  D  + LWDL  G+     + HT
Sbjct: 64  GPLAWIPPSDRFPEGGLVSGGMDTLVLLWDLHKGEVVETMKGHT 107


>07_03_0011 + 12370624-12370684,12372573-12372718,12372793-12373129,
            12374323-12374452,12375346-12375406,12375572-12375618,
            12376873-12376950,12377195-12377345,12377495-12377558,
            12377735-12377893,12378007-12378128,12378952-12378981,
            12379050-12379124,12379563-12379644,12379809-12379938,
            12381417-12382164,12382833-12383054,12383127-12383276,
            12384851-12384904,12384985-12385058,12386130-12386204,
            12386365-12386584
          Length = 1071

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 22/78 (28%), Positives = 37/78 (47%)
 Frame = +2

Query: 110  NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
            NP    ++ S+S D T+ +W++ +    Y      L GH   +  V  S  G Y  SGS 
Sbjct: 965  NPNQQLLLASASFDSTIKLWEVEQGRLLYS-----LAGHRQPVYSVAFSPGGEYLASGSL 1019

Query: 290  DKTLRLWDLAAGKTTRRF 343
            D+ L +W +  G+  + +
Sbjct: 1020 DQCLHIWSVKEGRILKTY 1037



 Score = 35.9 bits (79), Expect = 0.026
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = +2

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           N+ G  ++ L+ H   I  +  +  G++ LSGS DKT  +WD    +  ++FE H+
Sbjct: 356 NSDGELKQTLFKHKGPIFSLKWNKKGDFLLSGSVDKTAIVWDTKTWECKQQFEFHS 411



 Score = 31.1 bits (67), Expect = 0.75
 Identities = 17/38 (44%), Positives = 22/38 (57%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           +L+ TL  H G +  +  N K  D +LS S DKT IVW
Sbjct: 360 ELKQTLFKHKGPIFSLKWNKK-GDFLLSGSVDKTAIVW 396


>03_05_0724 -
           27147479-27147706,27147830-27147920,27148002-27148060,
           27148197-27148312,27148389-27148472,27148677-27148824,
           27148958-27149103,27149610-27149729,27149900-27149998,
           27150787-27150828,27150915-27151017
          Length = 411

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 22/73 (30%), Positives = 36/73 (49%)
 Frame = +2

Query: 101 IATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALS 280
           +A +P    ++ S  +D    +WK+   E+        L GH+  +  V  SSDGN   S
Sbjct: 87  VACSPTDASLVASGGKDDRGFLWKIGSAEDVL-----ELAGHTDTVCTVAFSSDGNLLAS 141

Query: 281 GSWDKTLRLWDLA 319
           GS+D  + +W+ A
Sbjct: 142 GSFDGRINVWNTA 154



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 26/88 (29%), Positives = 40/88 (45%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T  L+GTL G       +  +P+   +I++ S D  L +W    D N          GHS
Sbjct: 155 TRTLQGTLEGSGSGFEWLKWHPR-GHLIIAGSEDCNLWMWNA--DHNAI---LNTFAGHS 208

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWD 313
             ++    + DG    +GS D +LR+WD
Sbjct: 209 STVTCGDFTPDGKLICTGSDDASLRIWD 236



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 2/91 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDM--ILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T + R  +RGH      +       D   I+S S+D ++ V  +     N G     L G
Sbjct: 239 TAQSRHVVRGHGYHTDGLTCLSVTSDSQTIVSGSKDNSVCVVNI-----NSGQVVGSLDG 293

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           H+  I  V +S   N+  +GS D+ L +WDL
Sbjct: 294 HTGSIECVGISPSYNWVATGSMDQKLIIWDL 324



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 27/113 (23%), Positives = 54/113 (47%), Gaps = 1/113 (0%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG-HSHFISD 244
           T  GH+  VT     P    +I + S D +L +W     ++ + +   R +G H+  ++ 
Sbjct: 203 TFAGHSSTVTCGDFTPD-GKLICTGSDDASLRIWDPRTAQSRHVV---RGHGYHTDGLTC 258

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNADY 403
           + ++SD    +SGS D ++ + ++ +G+     + HT     S  C G++  Y
Sbjct: 259 LSVTSDSQTIVSGSKDNSVCVVNINSGQVVGSLDGHT----GSIECVGISPSY 307


>01_01_0974 +
           7678211-7678276,7678974-7679063,7679144-7679255,
           7679959-7679986,7680163-7680261,7680614-7680683,
           7680765-7680799,7680895-7680969,7681054-7681149,
           7681376-7681439,7682273-7682358,7682800-7682860,
           7682956-7683020,7683255-7683360,7684142-7684230,
           7684353-7684515
          Length = 434

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 25/82 (30%), Positives = 38/82 (46%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           G + GH   V+ +A NP Y   I S S D  + +W +   +     P     GH   +  
Sbjct: 60  GAMDGHVDAVSCMAKNPNYLKAIFSGSMDGDIRLWDIAARKTVCQFP-----GHQGAVRG 114

Query: 245 VVLSSDGNYALSGSWDKTLRLW 310
           +  S+DG+  +S   D T+RLW
Sbjct: 115 LATSTDGDLLVSCGVDCTVRLW 136



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 3/47 (6%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYA---LSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH   +S   ++ + NY     SGS D  +RLWD+AA KT  +F  H
Sbjct: 64  GHVDAVS--CMAKNPNYLKAIFSGSMDGDIRLWDIAARKTVCQFPGH 108



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 24/85 (28%), Positives = 40/85 (47%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  I  +P   + + + S D+T+ +++   D +      KR+      +  V  
Sbjct: 268 KGHVSAVMDIDYSPTGREFV-TGSYDRTVRIFQYNGDHSREIYHTKRMQR----VFCVKY 322

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGK 328
           + DG Y +SGS D  LRLW   A +
Sbjct: 323 TYDGTYLVSGSDDTNLRLWKSKASE 347


>06_03_0914 +
           25920277-25920405,25920783-25920810,25920890-25920990,
           25921356-25921479,25921793-25921903,25922222-25922397,
           25922766-25922848,25922935-25923007,25923630-25923695,
           25923776-25923818,25924600-25924739,25924878-25925090,
           25925397-25925481,25925558-25925852,25926855-25927110,
           25927237-25927450,25927701-25927912,25928054-25928203
          Length = 832

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 15/40 (37%), Positives = 26/40 (65%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           +R  GH+  ++D+  S DG + +S S D TLR+WD++  +
Sbjct: 481 RRFEGHTDRVTDLCFSEDGKWLISSSMDGTLRIWDISLAR 520


>03_05_0887 - 28527602-28530555,28531296-28531790,28532377-28532584
          Length = 1218

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 23/81 (28%), Positives = 45/81 (55%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V   + +P  P +I+S + D+ + +W++  D   + +   R  GH + +S V+
Sbjct: 200 LEGHDRGVNWASFHPTLP-LIVSGADDRQVKIWRMN-DTKAWEVDTLR--GHMNNVSCVM 255

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
             +  +  +S S DK++R+WD
Sbjct: 256 FHAKQDIIVSNSEDKSIRIWD 276



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 23/85 (27%), Positives = 45/85 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++  +  + + P  I+S+S D+T+ +W   +      +    L GH+H++   
Sbjct: 88  TLHGHLDYIRTVQFHHECP-WIVSASDDQTIRIWNW-QSRTCVAV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAA 322
                 +  +S S D+T+R+WD++A
Sbjct: 142 SFHPKEDLVVSASLDQTVRVWDISA 166



 Score = 31.5 bits (68), Expect = 0.57
 Identities = 15/38 (39%), Positives = 25/38 (65%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           TLRGH   V+ +  + K  D+I+S+S DK++ +W  T+
Sbjct: 243 TLRGHMNNVSCVMFHAKQ-DIIVSNSEDKSIRIWDATK 279


>01_07_0188 -
           41866689-41866763,41866889-41867155,41867277-41867722,
           41867945-41868033,41868279-41868368,41868661-41868739,
           41868979-41869042,41869597-41869684,41869776-41869836,
           41869906-41869969,41870134-41870188,41870275-41870346,
           41870469-41870551,41870629-41870724,41871279-41871383,
           41872159-41872227,41872470-41872561,41872667-41872886
          Length = 704

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 23/98 (23%), Positives = 49/98 (50%), Gaps = 1/98 (1%)
 Frame = +2

Query: 68  TLRGHNGW-VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           T++  +GW V  +  +P    +++S  +D  + +W     +   G   +  +GH + +  
Sbjct: 262 TVKPGHGWDVKSVDWHPT-KSLLVSGGKDYLVKLW-----DAKSGRELRSFHGHKNIVQC 315

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           V  + +GN+ L+ S D+ ++L+D+ + K    F  H K
Sbjct: 316 VKWNQNGNWVLTASKDQIIKLYDIRSMKELESFRGHNK 353



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/49 (28%), Positives = 22/49 (44%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*Q 367
           GH   +  V      +  +SG  D  ++LWD  +G+  R F  H  + Q
Sbjct: 266 GHGWDVKSVDWHPTKSLLVSGGKDYLVKLWDAKSGRELRSFHGHKNIVQ 314


>01_06_0898 -
           32832665-32832724,32832761-32832815,32832957-32833135,
           32833218-32833328,32833600-32833647,32833810-32833949,
           32834402-32834539,32834660-32834804,32834936-32835002,
           32835226-32835329,32835444-32835647
          Length = 416

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 18/43 (41%), Positives = 27/43 (62%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           ++L GHS  I+D   SS+  Y  S S DKT+R+W+++ G   R
Sbjct: 209 QKLIGHSKDITDFDFSSNNQYIASCSMDKTMRVWEISKGTCIR 251


>01_03_0084 -
           12286416-12286514,12286632-12286683,12286771-12286871,
           12287498-12287650,12287703-12287762,12287872-12287998,
           12288581-12288708,12289196-12289291,12289473-12289526,
           12289603-12289689,12290954-12291057,12291163-12291246,
           12291374-12291422,12291523-12291886,12292186-12292226
          Length = 532

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVVLSSDGNYALSGSWDKTL 301
           +M+ S S+D  + VW++       G   +RL   H+  ++ V  S DG   LS S+D T 
Sbjct: 281 EMLASGSQDGKIKVWRIRT-----GQCLRRLERAHAKGVTSVTFSRDGTQILSSSFDTTA 335

Query: 302 RLWDLAAGKTTRRFEDH 352
           R+  L +GK  + F  H
Sbjct: 336 RVHGLKSGKMLKEFRGH 352



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 28/85 (32%), Positives = 42/85 (49%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR   R H   VT + T  +    ILSSS D T  V  L       G   K   GH+ ++
Sbjct: 303 LRRLERAHAKGVTSV-TFSRDGTQILSSSFDTTARVHGLKS-----GKMLKEFRGHNSYV 356

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWD 313
           +  + S+DG+  ++ S D T+++WD
Sbjct: 357 NCAIFSTDGSRVITASSDCTVKVWD 381



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 13/41 (31%), Positives = 19/41 (46%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           H   +  V  S D     SGS D  +++W +  G+  RR E
Sbjct: 267 HDDAVLSVDFSRDSEMLASGSQDGKIKVWRIRTGQCLRRLE 307


>09_06_0121 +
           20975132-20975755,20976834-20976977,20977333-20977457,
           20978090-20978194,20978755-20978989
          Length = 410

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 27/98 (27%), Positives = 39/98 (39%), Gaps = 2/98 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDV 247
           LRGH      +A +P    ++LS S DK + +W L        +    ++  H   + DV
Sbjct: 158 LRGHEAEGYGLAWSPMKEGLLLSGSYDKKICLWDLAAGSGASSLDAHHVFEAHDDVVEDV 217

Query: 248 VLS-SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                D N   S   D  L +WDL   K  +    H K
Sbjct: 218 AWHLKDENLFGSAGDDCKLMMWDLRTNKPGQSIVAHQK 255



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 31/118 (26%), Positives = 61/118 (51%), Gaps = 12/118 (10%)
 Frame = +2

Query: 2   ASGXSSLFKPFS--KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           ASG +++ K F   K+S +L +  +     G V Q+  NP    ++ SS+ DK +++W +
Sbjct: 273 ASGDATI-KLFDLRKLSRSLHVFDSHDSCRGEVFQVEWNPNLETVLASSAADKRVMIWDV 331

Query: 176 TR-------DENNYGIPQKRLY--GHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLA 319
           +R       ++ N G P+      GH+  IS++  +    + + S + D  L++W++A
Sbjct: 332 SRIGDEQAEEDANDGPPELLFVHGGHTAKISELSWNPTQKWVMASVAEDNILQIWEMA 389


>11_01_0559 -
           4406815-4406922,4408954-4409042,4409177-4409270,
           4409344-4409481,4409570-4409727,4409826-4409916,
           4410003-4411637
          Length = 770

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +A +  Y  ++LSSS DKT+ +W      +       +L+ H+ +++ V
Sbjct: 527 SLEGHLDDVLDLAWS-MYSQLLLSSSMDKTVRLW------DTEAKACLKLFPHNDYVTCV 579

Query: 248 VLSS-DGNYALSGSWDKTLRLWDLA 319
             +  D  Y +SGS D  +R+W +A
Sbjct: 580 QFNPVDDGYFISGSLDSKVRIWSVA 604



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 18/47 (38%), Positives = 22/47 (46%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           P   L GH   + D+  S      LS S DKT+RLWD  A    + F
Sbjct: 524 PACSLEGHLDDVLDLAWSMYSQLLLSSSMDKTVRLWDTEAKACLKLF 570


>01_04_0102 +
           16030094-16030462,16030595-16030714,16031715-16031792,
           16032760-16032933,16033844-16033921,16034338-16034510,
           16034757-16034912,16036460-16036621,16036815-16036826,
           16036947-16036962,16037663-16037875
          Length = 516

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 26/93 (27%), Positives = 42/93 (45%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+   +  H+  V  +    +  D++ S S D    VW   R  N  G     L GH   
Sbjct: 238 KVTERIHAHSADVNAVTFADEGSDVLYSGSDDSLCKVWD--RRCNKRGKQVGVLTGHLDG 295

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           I+ +    DG+Y +S   D+T++LWD+    +T
Sbjct: 296 ITFIDSRGDGHYFISNCKDQTIKLWDIRKMSST 328


>01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902,
            4675953-4676072,4676185-4676313,4676394-4676442,
            4676899-4676970,4677574-4677707,4677798-4677915,
            4678332-4678541,4678630-4678942,4679539-4679632,
            4679854-4679962,4680243-4680514,4680597-4680724,
            4680832-4681066,4681570-4681758,4681845-4682128,
            4682218-4682398,4682486-4682728,4682904-4682986,
            4683119-4683227,4687996-4688091,4688675-4688764,
            4688881-4689129,4689233-4689412,4690179-4690250,
            4691385-4691474,4691605-4691705,4691794-4691959
          Length = 1757

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 25/98 (25%), Positives = 48/98 (48%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            ++ +LR  +G V  +       +M+ + + D  ++ WK+   + + G P   L GH   +
Sbjct: 1480 MKSSLREPSGLVCSMTIKD---EMLFAGTGDGRIMAWKIPDKKGDSG-PVAILSGHERQV 1535

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              + +S    Y  SGS DKT+++WDL   +  +   +H
Sbjct: 1536 ISLGVSVTRLY--SGSLDKTIKVWDLKTLQCVQTLSEH 1571


>02_04_0149 +
           20201674-20201891,20202009-20202111,20202658-20202765,
           20202882-20202991,20203170-20203277,20203667-20203733,
           20204044-20204078,20204456-20204501,20204692-20204844
          Length = 315

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 26/94 (27%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V  +  N +  +  LS  +D+ + +W       + G   K    H   + DV 
Sbjct: 17  LSGHEGAVLAVRFN-RDGNYCLSCGKDRIIRLWN-----PHTGALVKPYKSHGREVRDVN 70

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            SSD    +S   D+ +  WD+A+ +  R+F  H
Sbjct: 71  SSSDNAKLVSCGGDRQVFYWDVASARVIRKFRGH 104


>10_08_0299 -
           16607152-16607322,16607465-16607785,16607870-16608121,
           16608298-16608435,16608544-16608651,16608814-16609014,
           16609109-16609233,16609252-16609321,16609919-16610455
          Length = 640

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR-FED 349
           H+  I+ V  S+DG   LS S D TL++WDL   KT  + FED
Sbjct: 367 HTEDITGVKFSTDGQILLSRSMDSTLKIWDLRKMKTPLKVFED 409



 Score = 34.7 bits (76), Expect = 0.061
 Identities = 20/89 (22%), Positives = 43/89 (48%), Gaps = 1/89 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF-ISDVV 250
           +GH   +T    NPK  + IL+SS D ++ +W ++  ++   + + +L       ++   
Sbjct: 270 KGHISGLTGGEWNPKSKETILTSSEDGSIRLWDVSDFKSQKQVIKPKLARPMRIPVTSCA 329

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
              +G   + G  D +++LW +  G  +R
Sbjct: 330 WDHEGKRIVGGIGDGSIQLWTVKTGWGSR 358


>04_04_0589 +
           26449184-26450500,26452220-26452310,26452428-26452585,
           26452670-26452768,26453296-26453345,26453654-26453705,
           26453773-26454058,26454286-26454400,26454938-26455020,
           26455381-26455466
          Length = 778

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH+  V  +  +      +LSSS DKT+ +W ++R          + + HS +++ +
Sbjct: 422 TFEGHSEDVLDLCWSKS--QYLLSSSMDKTVKLWHMSRTSC------LKTFSHSDYVTCI 473

Query: 248 VLSS-DGNYALSGSWDKTLRLWDL 316
             +  D  Y +SGS D+ +R+W +
Sbjct: 474 QFNPVDDRYFISGSLDEKVRIWSI 497



 Score = 34.3 bits (75), Expect = 0.080
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           P K   GHS  + D+  S    Y LS S DKT++LW ++     + F
Sbjct: 419 PVKTFEGHSEDVLDLCWSKS-QYLLSSSMDKTVKLWHMSRTSCLKTF 464


>10_08_0316 -
           16688911-16689044,16689141-16689211,16689303-16689354,
           16689589-16689685,16689764-16689841,16689938-16690054,
           16690172-16690276,16691026-16691100,16691297-16691356,
           16691454-16691549,16691838-16691954,16692142-16692260,
           16692349-16692490,16694204-16694290,16694852-16694914,
           16695081-16695161
          Length = 497

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 23/86 (26%), Positives = 44/86 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  +T +   P+  ++ ++ S DKT+ +W+   +E NY      L  H+  +  V
Sbjct: 228 TLTGHSKKITSLKFVPR-DELFVTGSADKTVKIWQ-GSEEGNYNCIH-TLKDHTAEVEAV 284

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAG 325
            + +   Y ++ S D T   +D+ +G
Sbjct: 285 TVHATQKYFVTASKDNTWCFYDIPSG 310


>04_04_1180 - 31519713-31521419,31522308-31522533,31524097-31524215
          Length = 683

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 18/47 (38%), Positives = 28/47 (59%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           P+ RL+GH   ++ + L  D     SGSWD T+R+WD +  K  ++F
Sbjct: 388 PEFRLWGHEGPVTCLAL--DSLRIFSGSWDMTVRVWDRSEMKCVQKF 432



 Score = 29.9 bits (64), Expect = 1.7
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 1/59 (1%)
 Frame = +2

Query: 152 KTLIVWKLTRDENNYG-IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           KTL V +  R ++  G      L  HS  +  V L +  N   +G  D  +R+WDL  G
Sbjct: 274 KTLFVEREFRSKSFMGRFSVDVLRDHSEDVRTVFLLASVNLIFTGGNDSVIRMWDLEEG 332


>01_05_0816 +
           25462571-25462630,25462752-25462838,25462929-25462961,
           25462962-25463030,25463146-25463339,25463632-25463773,
           25464126-25464165,25464428-25464594,25465114-25465116,
           25465371-25465499,25465811-25465888,25465974-25465979
          Length = 335

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 22/62 (35%), Positives = 30/62 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S   DK + +W L       G P   L GH   + ++      N  +SGSWDKTLR W
Sbjct: 96  VFSGGCDKQIKMWPLLSG----GQPMV-LSGHEAPVKELAWIPQMNLLVSGSWDKTLRYW 150

Query: 311 DL 316
           D+
Sbjct: 151 DV 152


>11_01_0702 -
           5782202-5782277,5782692-5782760,5782878-5783026,
           5783119-5783250,5783343-5783671,5784166-5784172
          Length = 253

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 26/93 (27%), Positives = 38/93 (40%), Gaps = 2/93 (2%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           +G   QI  NPK       +S      VW +    + +      L GH   +      + 
Sbjct: 87  HGVAYQIKFNPKDTHKFAVASLMDAQ-VWNIRSSRHEF-----TLSGHVSIVDCFDFFTR 140

Query: 263 GN--YALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GN  Y ++GSWDKT ++WD       +  E HT
Sbjct: 141 GNQLYMITGSWDKTAKIWDCQRRTCVQTLEGHT 173



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 21/66 (31%), Positives = 32/66 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S DKT  +W   R         + L GH+  I+ V    D    L+GS D+T+RLW
Sbjct: 146 MITGSWDKTAKIWDCQRRTC-----VQTLEGHTDCITCVCSHPDLPILLTGSNDETVRLW 200

Query: 311 DLAAGK 328
           +    K
Sbjct: 201 NATTFK 206


>03_05_1112 +
           30488678-30488806,30489047-30489228,30489310-30489505,
           30490095-30491117
          Length = 509

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 22/99 (22%), Positives = 44/99 (44%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R T+R H+G    I       D ++S  +D+T+ +W       + G     L G    ++
Sbjct: 221 RITIRAHDGGCGSIIFQHN-TDKLISGGQDQTVKIWSA-----HTGALTSTLQGCLGSVN 274

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           D+ +++D  + ++      L +W++  G+       HTK
Sbjct: 275 DLAVTNDNKFVIAACSSNKLFVWEVNGGRPRHTLTGHTK 313



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 30/100 (30%), Positives = 44/100 (44%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R TL GH   V+ +  +     ++ SSS D T+ +W L       G  +  +   S+  S
Sbjct: 305 RHTLTGHTKNVSSVDASWVKSCVLASSSNDHTIKIWDLQS-----GFCKSTIMSGSNANS 359

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
              +  DG    SG  D  LRLWD+ + K T +   H  V
Sbjct: 360 LAFI--DGVTLCSGHRDGHLRLWDIRSAKCTSQTFAHLDV 397


>03_05_0700 +
           26920743-26920771,26920880-26920991,26921205-26921306,
           26921391-26921503,26921858-26921927,26922348-26922425,
           26922500-26922616,26922738-26922832,26923080-26923159,
           26923405-26923532
          Length = 307

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           H+  +  V    DGN+  SGS D T+R+WDL      R +E    V
Sbjct: 88  HTSNVMAVGFHCDGNWMYSGSEDGTVRIWDLRTATCQREYESRAAV 133



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 19/62 (30%), Positives = 29/62 (46%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S S D T+ +W L           +R Y     ++ VVL  +    +SG  +  +R+WDL
Sbjct: 106 SGSEDGTVRIWDLRT------ATCQREYESRAAVNTVVLHPNQKELISGDQNGNIRVWDL 159

Query: 317 AA 322
           AA
Sbjct: 160 AA 161


>12_01_0503 - 3981603-3981730,3982858-3983023,3983057-3983139,
            3983250-3983301,3983497-3983654,3983756-3985617,
            3986029-3986093,3986176-3986340,3986836-3986893,
            3987479-3987590,3987661-3987712,3988080-3988140,
            3988220-3988377,3988705-3988787,3988897-3988945,
            3989122-3989185,3990225-3990317,3990410-3990543,
            3991364-3991585,3991815-3991937,3992103-3992267,
            3993064-3993450
          Length = 1479

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +  +    D +LSSS DKT+ +W  T           +++ H+ +++ + 
Sbjct: 1238 LEGHQDDVLDLTWSKT--DQLLSSSMDKTVRLWDTTTK------ACLKVFAHNDYVTCIQ 1289

Query: 251  LS-SDGNYALSGSWDKTLRLWDL 316
             + +D  + +SGS D  +RLW +
Sbjct: 1290 FNPADDRFFISGSLDAKVRLWSI 1312


>02_04_0131 -
           20046033-20046505,20047140-20047233,20047343-20047434,
           20047560-20047611,20047721-20047878,20048190-20048280,
           20048397-20049455
          Length = 672

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  +A +    D +LSSS+D T+ +WK+      Y      ++ H  +++ V  
Sbjct: 338 QGHTSDVLDLAWSKS--DFLLSSSKDTTIRMWKV----GCYDC--LAVFRHGDYVTCVQF 389

Query: 254 SS-DGNYALSGSWDKTLRLWDLA 319
           +  D  Y +SGS D  +R+WD++
Sbjct: 390 NPVDERYFISGSIDGKVRVWDVS 412



 Score = 29.9 bits (64), Expect = 1.7
 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK-RLYGHSHFISDVVLSSDGN 268
           +T I  +  +P  ++ +S+D  +      R    + I QK +    S  +    L+ DG 
Sbjct: 480 ITNIQFSQGHPSRMIITSKDHKI------RVSEGHKITQKFQGQWRSKVLVPPSLTPDGR 533

Query: 269 YALSGSWDKTLRLWDLAAGKTTRR 340
           Y +S   D  +R+W+   G   RR
Sbjct: 534 YLISAGRDSKIRIWNFDGGGRRRR 557


>08_02_0130 -
           12900202-12900277,12901457-12901536,12901654-12901740,
           12902475-12902636,12904766-12904855,12904959-12905078,
           12905671-12905798,12905873-12906272
          Length = 380

 Score = 36.7 bits (81), Expect = 0.015
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 2/94 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH   +T +  N +  D++ S ++D T  VW     +N   +   R  GH+  +    
Sbjct: 6   MKGHERPLTFLRYN-RDGDLLFSCAKDHTPNVWFA---DNGDRLGTYR--GHNGAVWSCD 59

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKT--TRRFE 346
           +S D    ++GS D+T +LWD+  G+   T RF+
Sbjct: 60  VSRDSTRLITGSADQTAKLWDVQTGRELFTFRFD 93



 Score = 34.3 bits (75), Expect = 0.080
 Identities = 17/61 (27%), Positives = 34/61 (55%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I+++  D T+ +W     +      +++  GH   I+ +  S+D ++ L+GS DK+ +LW
Sbjct: 161 IITAGEDATIRIWDTETGQCLKESDKEQ--GHQKTITSLSKSADWSHFLTGSLDKSAKLW 218

Query: 311 D 313
           D
Sbjct: 219 D 219


>04_04_0454 + 25348189-25348516,25349154-25349869
          Length = 347

 Score = 36.7 bits (81), Expect = 0.015
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKT 298
           P ++ S S D +   W L ++ +N     K+   H+  +  +  +  +GN  L+GS+D+ 
Sbjct: 180 PHLLYSGSDDCSFSCWDLRQNPSNAVFQNKK--SHNMGVCCIAQNPLEGNMLLTGSYDEF 237

Query: 299 LRLWDL 316
           LR+WD+
Sbjct: 238 LRVWDI 243



 Score = 29.1 bits (62), Expect = 3.0
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           + HN  V  IA NP   +M+L+ S D+ L VW +
Sbjct: 210 KSHNMGVCCIAQNPLEGNMLLTGSYDEFLRVWDI 243


>03_05_0802 -
           27823213-27823701,27823911-27823959,27824053-27824120,
           27824208-27824276,27824391-27824460,27824556-27824635,
           27824706-27824784,27824949-27825025,27825110-27825176,
           27825285-27825381,27825478-27825574,27825701-27825739,
           27825843-27825907,27826034-27826142,27826275-27826487
          Length = 555

 Score = 36.7 bits (81), Expect = 0.015
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           E  K  G L GH G V  ++ +   P++I++ SRD +  +W L  D
Sbjct: 149 ENKKCLGVLSGHTGSVKSLSCHSSNPELIVTGSRDGSFALWDLRID 194



 Score = 31.1 bits (67), Expect = 0.75
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H++ I DV    DG+  L+ S D+T+++W +   K       HT
Sbjct: 118 HNNAIFDVCWIKDGSQLLTASGDQTVKIWSVENKKCLGVLSGHT 161


>01_01_0272 -
           2249662-2249721,2250110-2250335,2250419-2250615,
           2250707-2250955,2251047-2251176,2251473-2251564,
           2251735-2251855,2251940-2252028,2252149-2252271,
           2252379-2252506,2253039-2253147,2253701-2254000
          Length = 607

 Score = 36.7 bits (81), Expect = 0.015
 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 1/79 (1%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGN 268
           VT +  NP  P+++LSS  D    +W   + E N          H   ++    S   GN
Sbjct: 343 VTSLHCNPAQPEVLLSSGNDHYARIWDTRKLEPNSAFVS---LAHGRVVNSGYFSPQSGN 399

Query: 269 YALSGSWDKTLRLWDLAAG 325
             L+   D  +R+WD   G
Sbjct: 400 KILTTCQDNRIRVWDYIFG 418


>05_04_0278 -
           19694590-19694757,19696331-19696391,19696503-19696658,
           19696740-19696912,19698199-19698276,19698399-19698575,
           19698924-19699001,19700573-19700692,19700803-19701183
          Length = 463

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 28/103 (27%), Positives = 43/103 (41%), Gaps = 3/103 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW--KLTRDENNYGIPQKRLYGHS 229
           KL   L  H+  V  +A   +   +I S S D    VW  +    E   G+    L GH 
Sbjct: 243 KLTLRLPAHHSDVNTVAFADETGHLIYSGSDDNLCKVWDRRCLSTEEPAGV----LTGHL 298

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDL-AAGKTTRRFEDHT 355
           H I+ +    DG   +S   D+ +++WD+         +ED T
Sbjct: 299 HGITHIDSRGDGRCFISNGKDQAIKMWDIRKMTSNADSYEDRT 341



 Score = 31.9 bits (69), Expect = 0.43
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           I  V  SSDG   ++GS D ++ ++DL A K T R   H
Sbjct: 213 IFSVKFSSDGRELVAGSNDDSIYVYDLVANKLTLRLPAH 251


>04_04_0270 - 24061852-24063264
          Length = 470

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 14/29 (48%), Positives = 19/29 (65%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           H+  +S V  S+DG    S SWDKTL++W
Sbjct: 223 HADAVSGVAASADGRLLFSVSWDKTLKVW 251



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 4/88 (4%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL  H   V  +A       ++ S   D+ ++VW+   D  ++ +    L GH   +
Sbjct: 316 LVATLSRHAAAVNAVAVGCG-GQVLYSGGNDRCVVVWE-REDSASHMVAVGALRGHRRAV 373

Query: 239 SDVVLSS----DGNYALSGSWDKTLRLW 310
             V  ++    DG   +SG+ D+T+R W
Sbjct: 374 LSVACAAGDAADGALVVSGAADQTVRAW 401


>04_03_0897 -
           20646750-20646918,20647927-20648038,20649650-20650108,
           20650237-20650330,20650449-20650525,20650637-20650688,
           20650770-20650927,20651191-20651281,20651465-20652529
          Length = 758

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 1/97 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  +A +    D +L+SS+DK + +WK+  D    G     L+ H  +++ V  
Sbjct: 340 QGHTDDILDMAWSES--DYLLTSSKDKMVRLWKVGCD-GCLG-----LFKHKDYVTCVQF 391

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +  D  Y +SGS D  +R+WD A  K    + D  K+
Sbjct: 392 NPIDERYFISGSIDGKVRVWD-ALDKRVVDWTDTRKI 427


>02_01_0283 + 1903869-1904786
          Length = 305

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVWK 172
           TL GH G V Q+A  +PKY  ++ S S D  +I+WK
Sbjct: 50  TLSGHQGPVWQVAWAHPKYGSLLASCSYDGRVIIWK 85


>09_02_0319 +
           7217262-7217372,7218026-7218121,7218642-7218771,
           7219137-7219225,7219764-7219832,7220229-7220286,
           7220374-7220489
          Length = 222

 Score = 35.9 bits (79), Expect = 0.026
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L+GH   V Q+  +PK+PD + +++ DK++ +W
Sbjct: 77  LKGHTDCVDQLCWDPKHPDTVATAAADKSIRLW 109



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 1/85 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +A N      + S S D T  VW +     +  +    L GH+  +  +   
Sbjct: 33  GHKKKVHSVAWNC-LGMKLASGSIDHTARVWSID-PHGHSKVKDIELKGHTDCVDQLCWD 90

Query: 257 -SDGNYALSGSWDKTLRLWDLAAGK 328
               +   + + DK++RLWD  +GK
Sbjct: 91  PKHPDTVATAAADKSIRLWDARSGK 115


>03_01_0320 - 2510907-2512190
          Length = 427

 Score = 35.9 bits (79), Expect = 0.026
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 1/96 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRG    +T +    +  D + + + D  + +W++ +++ ++      L GH      VV
Sbjct: 207 LRGPASQITAMLAEDE--DHLFAGAEDGAVFMWRMNQEQQSFD-EVAALTGH---YKAVV 260

Query: 251 LSSDGNYAL-SGSWDKTLRLWDLAAGKTTRRFEDHT 355
             + G  AL SGS D ++R+WDL   +    F  H+
Sbjct: 261 SLAQGKGALYSGSTDGSIRVWDLDTHRCIYSFAGHS 296



 Score = 35.1 bits (77), Expect = 0.046
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           RL GH+  ++   L    +   SGS D T+R WD + G+  R
Sbjct: 126 RLKGHAKAVTGFALPEGSDKLFSGSLDSTVRAWDCSTGQCVR 167



 Score = 27.5 bits (58), Expect = 9.2
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+  VT +    ++   +LSSS D T+ VW+   D ++  +       ++H   + V+S
Sbjct: 294 GHSSTVTALLCWERF---LLSSSDDGTVKVWQWKPDHDDLDLE----VHYTHKEDERVVS 346

Query: 257 SDGNY 271
            DG Y
Sbjct: 347 MDGTY 351


>02_05_0698 + 31005555-31006763
          Length = 402

 Score = 35.9 bits (79), Expect = 0.026
 Identities = 23/84 (27%), Positives = 41/84 (48%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L GT+  H   V  +A       ++ S + D++++VW+     +        L GH+  I
Sbjct: 255 LVGTMERHRSAVNALALGAN-GKVLYSGACDRSVVVWESAGGGDGGMEATGTLRGHARAI 313

Query: 239 SDVVLSSDGNYALSGSWDKTLRLW 310
             + L++ G    SGS D+T+R+W
Sbjct: 314 --LCLAAAGELVCSGSADRTVRVW 335



 Score = 31.5 bits (68), Expect = 0.57
 Identities = 27/101 (26%), Positives = 47/101 (46%), Gaps = 13/101 (12%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           ++  GTLRGH   +  +A      +++ S S D+T+ VW+    ENN       +  H  
Sbjct: 300 MEATGTLRGHARAILCLAAAG---ELVCSGSADRTVRVWRRGGAENNGYTCLAVMESHGA 356

Query: 233 FISDVVL-----------SSDGNYAL--SGSWDKTLRLWDL 316
            +  + L           SS+G+ AL  SG+ D  +++W +
Sbjct: 357 AVKSLALVRGGRDDDGSCSSEGSSALVCSGALDGDVKIWSV 397



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 10/31 (32%), Positives = 19/31 (61%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           H   ++ + +S DG    S SWD+++++W L
Sbjct: 174 HVDAVTALAVSPDGALLYSASWDRSIKVWSL 204


>01_05_0653 -
           23948911-23948937,23949031-23949141,23949361-23949441,
           23949865-23949984,23950088-23950252,23950344-23950493,
           23950565-23950674,23951401-23951518,23951597-23951827,
           23952345-23952524,23953639-23953908,23954930-23954979,
           23955213-23955288,23955396-23955483,23956010-23956101,
           23956200-23956529,23957484-23957593,23957810-23957907,
           23959538-23959566
          Length = 811

 Score = 35.9 bits (79), Expect = 0.026
 Identities = 21/62 (33%), Positives = 34/62 (54%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ +   DK +++W  T D N   I ++    HS  I+DV  SS      + S+DKT+R+
Sbjct: 585 LLATGGHDKKVVLW-FTDDLNIKAIFEE----HSMIITDVRFSSIMTRLATSSFDKTIRV 639

Query: 308 WD 313
           WD
Sbjct: 640 WD 641


>05_01_0316 +
           2476689-2477030,2477164-2477283,2477742-2477819,
           2477956-2478132,2478317-2478394,2478694-2478866,
           2478994-2479149,2479573-2479633,2479831-2480049
          Length = 467

 Score = 35.5 bits (78), Expect = 0.035
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 3/90 (3%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWK---LTRDENNYGIPQKRLYGH 226
           K+   +R H   V  +    +  +++ S S D    VW    L R++     P   L GH
Sbjct: 230 KVSVRIRAHAADVNAVTFADESGNLLYSGSDDNLCKVWDRRCLAREK-----PAGVLTGH 284

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
              I+ +    DG Y +S   D+T++LWD+
Sbjct: 285 LDGITFIDSRGDGRYFISNCKDQTIKLWDV 314



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 14/43 (32%), Positives = 23/43 (53%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S  I  V  S DG   + G+ D+++ ++DL A K + R   H
Sbjct: 196 YSFGIFSVKFSKDGQEIVVGNSDRSINVYDLRANKVSVRIRAH 238


>03_01_0363 +
           2827990-2828055,2828215-2829306,2829715-2829837,
           2829994-2830110,2830248-2830429,2830558-2830744,
           2830846-2831055,2831177-2831305,2832179-2832247,
           2832751-2832873,2832957-2833007,2833101-2833250
          Length = 832

 Score = 35.5 bits (78), Expect = 0.035
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           LYGH   +  + +SSDG   ++GS DK L++W +  G   +    HT
Sbjct: 479 LYGHKLPVLCMDISSDGVLIVTGSADKNLKIWGMDFGDCHKSIFAHT 525



 Score = 31.1 bits (67), Expect = 0.75
 Identities = 17/59 (28%), Positives = 33/59 (55%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           S  +D+T+  W    D + + +    L GH   +  + +SS G++ ++GS D+++R WD
Sbjct: 527 SVGKDRTVKYW----DADKFEL-LLTLEGHHAEVWCLAISSRGDFIVTGSHDRSIRRWD 580



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 26/113 (23%), Positives = 49/113 (43%), Gaps = 4/113 (3%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDM----ILSSSRDKTLIVWKLTRDE 187
           L  P   +++  KL   LR  N  +  +A +P  P       LS S +  ++      +E
Sbjct: 190 LQNPTPVVTDIFKLLHVLRV-NKKICSVAFSPNNPPKGCLATLSLSLNNNMLETYSVDNE 248

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           N   +    ++GH   I  + L+S+ N  +S S    +++W+ + G   R  +
Sbjct: 249 NVSNMYSIEMHGHRSDIRSLALNSEDNLLMSTS-HNAVKIWNPSTGDCLRTID 300


>05_06_0102 -
           25589011-25589181,25589269-25589496,25589589-25589933,
           25590406-25590777,25590957-25591049,25591150-25591401,
           25592019-25593224
          Length = 888

 Score = 35.1 bits (77), Expect = 0.046
 Identities = 26/103 (25%), Positives = 43/103 (41%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           +G    F+ F    +T +L   L GH G V  +  +P    ++ SSS DKT+ +W +   
Sbjct: 479 AGTLDSFEIFVWSMKTGRLLDILSGHQGPVHGLMFSP-INAILASSSWDKTVRLWDVFES 537

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +          + HSH +  +    DG      + D  +  WD
Sbjct: 538 KGAV-----ETFQHSHDVLTLAYRPDGRQIACSTLDGLIHFWD 575



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           L GH   +  ++ S       S SWDKT+RLWD+   K
Sbjct: 501 LSGHQGPVHGLMFSPINAILASSSWDKTVRLWDVFESK 538



 Score = 29.9 bits (64), Expect = 1.7
 Identities = 18/66 (27%), Positives = 35/66 (53%)
 Frame = +2

Query: 158 LIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           L+VW+  R E+ Y + Q+   GH   ++ +  S D     +G+ D  +++W +++G    
Sbjct: 359 LLVWEW-RSES-YILKQQ---GHYFDVNCIAYSPDSQLLATGADDNKVKVWTVSSGFCFI 413

Query: 338 RFEDHT 355
            F +HT
Sbjct: 414 TFSEHT 419



 Score = 27.9 bits (59), Expect = 7.0
 Identities = 22/90 (24%), Positives = 41/90 (45%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  IA +P    ++ + + D  + VW ++      G        H++ ++ V  
Sbjct: 374 QGHYFDVNCIAYSPD-SQLLATGADDNKVKVWTVSS-----GFCFITFSEHTNAVTAVHF 427

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            ++ +  LS S D T+R WDL   +  + F
Sbjct: 428 MANNHSLLSASLDGTIRAWDLFRYRNFKTF 457


>05_03_0185 +
           9348559-9348958,9349560-9349687,9349782-9349808,
           9350250-9350369,9350474-9350563,9351206-9351292,
           9351410-9351489,9352843-9352918
          Length = 335

 Score = 34.7 bits (76), Expect = 0.061
 Identities = 23/85 (27%), Positives = 42/85 (49%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH   +T +  N +  D++ S ++D T  VW    + +  G       GH+  +    
Sbjct: 6   MKGHERPLTFLRYN-RDGDLLFSCAKDHTPNVW-FADNGDRLGTYS----GHNGAVWSCD 59

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAG 325
           +S D    ++GS D+T +LWD+  G
Sbjct: 60  VSRDSTRLITGSADQTAKLWDVQTG 84



 Score = 32.3 bits (70), Expect = 0.32
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           GH   I+ +  S+D ++ L+GS DK+ +LWD
Sbjct: 198 GHQKTITSLSKSADWSHFLTGSLDKSAKLWD 228


>04_04_1596 +
           34684943-34686340,34688085-34688175,34688290-34688354,
           34688530-34688581,34688747-34688829,34688942-34689035,
           34689468-34690051
          Length = 788

 Score = 34.7 bits (76), Expect = 0.061
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P   L GH+  + D+  S    Y LS S DKT++LWD+      + F  HT
Sbjct: 446 PVCSLLGHAADVLDLSWSKS-QYLLSSSMDKTVKLWDITTSTCLKTF-SHT 494



 Score = 29.9 bits (64), Expect = 1.7
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 1/81 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  ++ +      +LSSS DKT+ +W +T           + + H+ +++ +
Sbjct: 449 SLLGHAADVLDLSWSKS--QYLLSSSMDKTVKLWDITTS------TCLKTFSHTDYVTCI 500

Query: 248 VLSS-DGNYALSGSWDKTLRL 307
             +  D N+ +SGS D+ + L
Sbjct: 501 QFNPVDDNFFISGSLDEKVAL 521



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           + L  HS  I  +  S DG Y  S   D+ + +W+++ G+
Sbjct: 328 QELAAHSGSIWCINFSLDGRYLASAGEDRVIHVWEVSEGE 367


>04_04_0475 +
           25500470-25500609,25500697-25500794,25502806-25502915,
           25502998-25503293,25503399-25503474,25503577-25503688,
           25503955-25504004,25504090-25504392,25504446-25504547,
           25505463-25505635,25505745-25505917,25505997-25506106,
           25506180-25506329,25506726-25506881,25507000-25507116,
           25507277-25507474,25507809-25507952
          Length = 835

 Score = 34.7 bits (76), Expect = 0.061
 Identities = 18/76 (23%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S+  +K  ++W +   +  Y   +     H+  I+DV    + N   + S+D+T++L
Sbjct: 572 ILASAGHEKKAVLWNMETFQTQYTAEE-----HAVIITDVRFRPNSNQLATSSFDRTIKL 626

Query: 308 WDLA-AGKTTRRFEDH 352
           W+ A  G +   F  H
Sbjct: 627 WNAADPGFSLHTFAGH 642



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 19/88 (21%), Positives = 38/88 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           +R   G   Q+   P      L+++ +  + ++ +  +   Y      L GH+  +  V 
Sbjct: 679 MRAMKGGTAQVRFQPN-TGQFLAAATENVVSIFDVETNGKKY-----TLQGHNSEVQSVC 732

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTT 334
             S G Y  S S D  +++W +++G  T
Sbjct: 733 WDSSGQYLASVSQD-LVKVWSISSGDCT 759


>02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198,
            3366324-3366449,3367056-3367262,3367399-3367492,
            3367575-3367621,3367705-3368157,3368261-3368560,
            3368656-3369114,3369189-3369410,3369659-3369890,
            3370051-3370422,3371210-3371322,3371682-3371903,
            3371977-3372180,3372308-3372572,3373123-3373311,
            3373441-3373768,3373843-3374248,3374339-3374648,
            3375677-3375837,3376825-3376998,3377265-3377609,
            3377713-3377754,3378585-3378734,3378847-3379002,
            3379088-3379540,3379651-3379966,3380402-3380839,
            3381475-3381697,3383538-3383852,3384033-3384095,
            3384699-3384903,3385362-3385425,3386014-3386204
          Length = 3048

 Score = 34.7 bits (76), Expect = 0.061
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +2

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
            H   +S V +SSDG+   +GS+D T+ +W    GK+
Sbjct: 2808 HKDVVSCVAVSSDGSVIATGSYDTTVMIWHAFRGKS 2843


>08_01_0515 -
           4490855-4490902,4490992-4491072,4491752-4491823,
           4492296-4492373,4493316-4493444,4493862-4493942,
           4494064-4494205,4494672-4494865,4494962-4495027,
           4495108-4495194,4495326-4495376
          Length = 342

 Score = 34.3 bits (75), Expect = 0.080
 Identities = 19/61 (31%), Positives = 28/61 (45%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S   DK + +W L       G   + +  H   + ++      N  +SGSWDKTLR W
Sbjct: 81  VFSGGCDKQVKMWPLLS-----GGQAQTVAMHDAPVKEIAWIPQMNLLVSGSWDKTLRYW 135

Query: 311 D 313
           D
Sbjct: 136 D 136



 Score = 29.9 bits (64), Expect = 1.7
 Identities = 17/78 (21%), Positives = 36/78 (46%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           V+ ++ +PK  ++++++S D  +  W++    +      K    H   +       DG  
Sbjct: 26  VSSLSFSPK-SNLLVATSWDNQVRCWEIVGGSSQ----PKASISHDQPVLCSAWKDDGTT 80

Query: 272 ALSGSWDKTLRLWDLAAG 325
             SG  DK +++W L +G
Sbjct: 81  VFSGGCDKQVKMWPLLSG 98



 Score = 27.9 bits (59), Expect = 7.0
 Identities = 9/32 (28%), Positives = 17/32 (53%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           +S +  S   N  ++ SWD  +R W++  G +
Sbjct: 26  VSSLSFSPKSNLLVATSWDNQVRCWEIVGGSS 57


>07_01_0972 - 8176013-8176960
          Length = 315

 Score = 34.3 bits (75), Expect = 0.080
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVWK 172
           +L  TL GH G V ++A  +PKY  ++ S S D  +I+WK
Sbjct: 48  QLLATLSGHYGPVWRVAWAHPKYGTILASCSYDGRVIIWK 87


>06_03_1454 -
           30261240-30261470,30261896-30262615,30262700-30262843,
           30262953-30263204,30263542-30263751
          Length = 518

 Score = 34.3 bits (75), Expect = 0.080
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           QKRL  H   ++ +  + DG+  LSGS D+   LW+   G  T  F
Sbjct: 79  QKRLRKHRGCVNTISFNEDGSLLLSGSDDRAAVLWNWQEGTPTFAF 124


>06_03_0175 +
           17553447-17553667,17555313-17555467,17555625-17555713,
           17556253-17556376,17556920-17556989,17557345-17557441,
           17559365-17559427,17559504-17559581,17559675-17559737
          Length = 319

 Score = 34.3 bits (75), Expect = 0.080
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           N   S S DKT+++WD+AAGK     E H
Sbjct: 221 NILASASADKTVKIWDVAAGKCVTTLEHH 249


>09_03_0044 -
           11855569-11855664,11855775-11855891,11856572-11856682,
           11856768-11856874,11857182-11857221,11857328-11857408,
           11857578-11857631,11857800-11857860,11857984-11858029,
           11858276-11858352,11858448-11858563,11858654-11858890
          Length = 380

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 12/39 (30%), Positives = 22/39 (56%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           GH+ ++  + +       ++GS D T R+WD  +GK T+
Sbjct: 208 GHTDYLHSIAVREANRQVVTGSEDGTARIWDCRSGKCTQ 246


>03_01_0161 +
           1307206-1307769,1307979-1308101,1308182-1308286,
           1308688-1308867,1308988-1309050,1309151-1309345,
           1309704-1309805,1309885-1309947,1310045-1310113,
           1310215-1310270,1310587-1310755
          Length = 562

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 25/96 (26%), Positives = 44/96 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   V  +A N     ++ S SRDK+++   + R +++Y     RL GH   +  +
Sbjct: 276 TMESHRMRVGALAWNSS---LLSSGSRDKSILHHDI-RAQDDY---ISRLAGHKSEVCGL 328

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S D     SG  D  L +W+  +     ++ +HT
Sbjct: 329 KWSYDNRQLASGGNDNRLYVWNQHSAHPVLKYTEHT 364



 Score = 32.3 bits (70), Expect = 0.32
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH++ +  + +S DG   ++G+ D+TLR W++
Sbjct: 448 LTGHTYRVLYLAISPDGQTIVTGAGDETLRFWNV 481


>08_02_1540 +
           27694565-27694579,27696364-27696447,27696599-27696731,
           27696840-27696951,27697530-27697629,27697810-27697937,
           27698046-27698115,27698548-27698636,27698719-27698764,
           27698854-27698924,27699002-27699075,27699341-27699433,
           27699539-27699572,27699704-27699789,27702147-27702223,
           27702445-27702533,27702630-27702813,27703068-27703249,
           27703962-27704064,27704159-27704490,27704577-27705018,
           27705749-27705846,27706988-27707081,27707666-27707787,
           27708025-27708078,27708185-27708304,27708595-27708799,
           27708889-27709059,27709155-27709310,27709375-27709431,
           27709474-27709580,27709708-27709798,27709931-27710072,
           27710149-27710305,27710400-27710516,27710596-27710722,
           27710844-27711066,27711460-27711466,27711656-27711788
          Length = 1574

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH+ W   +  NP++  +ILS+  D T+ +W
Sbjct: 238 LPGHSHWTWAVRHNPEHDQLILSAGTDSTVNLW 270


>03_01_0107 +
           849489-850652,850745-850835,850926-851083,851180-851231,
           852373-852452,852540-852633,852711-853231,854087-854202,
           854242-854293
          Length = 775

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P    YGH   I D+  S + +  LS S DKT+RLW +      + F  HT
Sbjct: 368 PVHEFYGHDDAILDLSWSKNRDL-LSSSMDKTVRLWQVGCNSCLKVF-SHT 416



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
           +LSSS DKT+ +W++  +         +++ H+++++ V    +  NY +SG  D  +R+
Sbjct: 390 LLSSSMDKTVRLWQVGCNSC------LKVFSHTNYVTCVQFHPTSDNYFISGCIDGLVRI 443

Query: 308 WDL 316
           WD+
Sbjct: 444 WDV 446



 Score = 28.3 bits (60), Expect = 5.3
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H   I  +  SSDG Y  +G  D  +R+W +  G+
Sbjct: 270 HEGAIVTMKFSSDGQYLATGGEDGVVRVWRVVEGE 304


>01_05_0652 -
           23934604-23934636,23934783-23934893,23935000-23935188,
           23935893-23936012,23936109-23936273,23936638-23936790,
           23936867-23936976,23937280-23937397,23938197-23938427,
           23938984-23939175,23939661-23939945,23940637-23940686,
           23940846-23940921,23941048-23941135,23941689-23941771,
           23941883-23942248,23942462-23942476,23942909-23943018,
           23943134-23943231,23943961-23944019
          Length = 883

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 1/77 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ +   DK +++W  T        P   L  HS  I+DV  S   +   + S+DKT+R+
Sbjct: 618 LLATGGHDKKVLLW-CTEPALK---PTSSLEEHSALITDVRFSPSMSRLATSSFDKTVRV 673

Query: 308 WDL-AAGKTTRRFEDHT 355
           WD      + R F  H+
Sbjct: 674 WDADNTSYSLRTFTGHS 690


>01_01_0166 +
           1412918-1413309,1413845-1414006,1414534-1414720,
           1415221-1415646,1416028-1416036,1416361-1416768,
           1417397-1417654
          Length = 613

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 32/98 (32%), Positives = 45/98 (45%), Gaps = 4/98 (4%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG-HSH 232
           K + ++R H+ +V  I   P     I  SS  K LI    T D+    I +    G H+ 
Sbjct: 179 KFKHSIRDHSNFVNCIRYAPDGSKFISVSSDKKGLIYDGKTGDK----IGELSSEGSHTG 234

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDL---AAGKTTR 337
            I  V  S D    L+ S DKT ++WD+   A+GK  R
Sbjct: 235 SIYAVSWSPDSKQVLTVSADKTAKVWDILEDASGKLNR 272


>08_02_1111 +
           24377268-24377444,24377543-24377630,24378072-24378157,
           24378358-24378511,24378723-24378883,24378964-24379632,
           24379860-24380058,24380188-24380405,24380578-24380755,
           24380859-24381358
          Length = 809

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 20/80 (25%), Positives = 44/80 (55%), Gaps = 10/80 (12%)
 Frame = +2

Query: 71  LRGHNGWVTQI-------ATNPKYPDMILSSSRDKTLIVWKLTRD--ENNYGIPQKRLYG 223
           L+GH+ W+  +         + ++   ++SSS+D+T+ +WK+  D   + +  P+K   G
Sbjct: 229 LKGHSDWIRSLDFSLPVMMGSEEHSLFLVSSSQDRTIRIWKMNSDAVSSAHTTPRKEDIG 288

Query: 224 HSHFI-SDVVLSSDGNYALS 280
            + +I   + +SS+ +Y +S
Sbjct: 289 IASYIEGPLFVSSNTHYQVS 308



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR-DENNYGIPQKRLYGH 226
           T K  G L+ HN  VTQ+  + +    +LS SRD+ L V+ + + D+        +L  H
Sbjct: 600 TWKAVGRLQSHNLTVTQMEFS-RDNAFLLSVSRDRHLSVFSIRKTDDGAEHHLVAKLEAH 658

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
              I     +       +GS DKT+++W +
Sbjct: 659 KRIIWACSWNPFSYEFATGSRDKTVKIWSV 688



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 9/59 (15%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPK---------YPDMILSSSRDKTLIVWKLTRDENNYGI 202
           + L   L GH  WV  +   P           P  ILS+S DK +++WK    E N G+
Sbjct: 307 VSLESLLVGHEDWVYSVEWQPPTLLTDDEAHQPMSILSASMDKMMMIWK---PEKNTGL 362


>03_05_0378 -
           23619169-23619225,23619389-23619454,23620052-23620224,
           23620454-23620664,23621056-23621280,23622157-23622493,
           23624200-23624627
          Length = 498

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 12/103 (11%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKR-LYGH--------- 226
           H   VT +  + K  D   S+S+D  ++ W + T     Y  P +  L  H         
Sbjct: 159 HRQPVTAVVLS-KDSDKGFSASKDGVIVHWDVETGKSEKYLWPSENVLVSHHAKPPLSAK 217

Query: 227 -SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S  +  + +S+DG Y  SG  D+ + LWD+ + +  + F  H
Sbjct: 218 RSKQVLALAVSADGRYLASGGLDRHIHLWDVRSREHIQAFSGH 260



 Score = 30.7 bits (66), Expect = 0.99
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           K L  H   ++ VVLS D +   S S D  +  WD+  GK+ +
Sbjct: 154 KMLVKHRQPVTAVVLSKDSDKGFSASKDGVIVHWDVETGKSEK 196


>02_05_1194 -
           34881450-34881593,34882023-34882220,34882522-34882638,
           34882753-34882908,34883192-34883341,34883418-34883527,
           34883589-34883730,34883836-34884054,34887004-34887099,
           34887187-34887489,34887575-34887624,34888003-34888114,
           34888204-34888279,34888389-34888684,34888763-34888872,
           34889071-34889120,34890439-34890488,34890636-34890816,
           34890901-34890932
          Length = 863

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 15/64 (23%), Positives = 34/64 (53%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S+  +K  ++W +   ++ Y   +     HS  I+DV    + +   + S+D+T++L
Sbjct: 600 ILASAGHEKKAVLWNMDTFQSQYTSEE-----HSLIITDVRFRPNSSQLATSSFDRTIKL 654

Query: 308 WDLA 319
           W+ A
Sbjct: 655 WNAA 658



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           T  GHN  VT +  +PK  D++ S   +  +  W LT+
Sbjct: 666 TFVGHNVQVTSLDFHPKKTDLLCSCDGNGEIRYWNLTQ 703


>02_05_0890 -
           32546918-32547088,32547224-32547334,32547705-32547884,
           32547960-32548064,32548333-32548431,32548524-32548679,
           32548772-32548850,32549213-32549278,32549382-32549536,
           32549675-32550034,32550150-32550305,32550779-32550856,
           32551471-32551812
          Length = 685

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 21/57 (36%), Positives = 23/57 (40%)
 Frame = +2

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           D  N   P     GH   +S V   S    A S S D TLRLWD+      R F  H
Sbjct: 544 DLRNPSAPVHVFGGHKKAVSYVKFLSTNELA-SASTDSTLRLWDVKENCPVRTFRGH 599


>03_02_0614 +
           9863622-9863675,9864353-9864604,9865125-9865268,
           9865350-9866024,9866117-9866317,9866446-9866646
          Length = 508

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           G LRGH+G V  ++ NP   ++++S S D  +I+W
Sbjct: 28  GKLRGHDGCVNTVSFNPA-GNLLVSGSDDMDIILW 61



 Score = 30.7 bits (66), Expect = 0.99
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           +L GH   ++ V  +  GN  +SGS D  + LWD  A KT R
Sbjct: 29  KLRGHDGCVNTVSFNPAGNLLVSGSDDMDIILWDWLA-KTQR 69


>02_05_0300 +
           27681204-27681656,27681745-27681840,27681933-27682022,
           27682126-27682227,27682310-27682456,27683608-27683748,
           27683749-27683808,27685133-27685230,27685308-27685410,
           27685954-27686037
          Length = 457

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           L GH   ++ + L +  +   SGS D T+R+WD   G+
Sbjct: 146 LQGHEKVVTGIALPAGSDKLYSGSKDGTVRMWDCQTGQ 183


>02_05_0220 - 26885502-26885561,26885940-26886739,26887055-26887421,
            26887942-26888055,26888132-26888228,26889115-26889235,
            26889306-26889390,26889494-26889643,26889871-26889987,
            26890123-26890221,26890439-26890495,26890581-26890664,
            26890759-26890828,26891015-26891169,26891557-26892095,
            26892327-26892393,26892436-26892984,26893574-26893768,
            26894485-26894569,26895822-26896441,26897154-26897486,
            26897552-26897616,26897868-26897955,26898250-26898331,
            26898720-26898796,26899152-26899256,26899496-26899630,
            26900199-26900888,26901474-26902261,26902990-26904673
          Length = 2825

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +2

Query: 218  YGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            +GH   ++ V LS D NY ++GS D T+ LW
Sbjct: 2562 FGHLAPVTCVALSPDSNYLVTGSRDTTVILW 2592



 Score = 27.9 bits (59), Expect = 7.0
 Identities = 13/36 (36%), Positives = 23/36 (63%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
            T  GH   VT +A +P   + +++ SRD T+I+W++
Sbjct: 2560 TAFGHLAPVTCVALSPD-SNYLVTGSRDTTVILWRI 2594


>01_03_0103 - 12567986-12568141,12568307-12568442,12568751-12568824,
            12568932-12569175,12569480-12569766,12570618-12571103,
            12571348-12571459,12571540-12571745,12573071-12573276,
            12573831-12574162,12574284-12574825,12574967-12576308,
            12576386-12576457,12578438-12578505,12579011-12580174
          Length = 1808

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 4/73 (5%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVW----KLTRDENNYGIPQKRLYGHSHFIS 241
            R H+G +T++A    +  +I+SSS DKTL VW     L+   N Y      +   S +  
Sbjct: 1679 RAHDGHITKLAAPEDH--LIVSSSLDKTLRVWDLRGNLSTQSNIYRSHSDGIINFSAWGQ 1736

Query: 242  DVVLSSDGNYALS 280
            D+V  S    AL+
Sbjct: 1737 DMVSVSRNKIALT 1749



 Score = 28.3 bits (60), Expect = 5.3
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +2

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
            H   I+ +    D +  +S S DKTLR+WDL    +T+
Sbjct: 1681 HDGHITKLAAPED-HLIVSSSLDKTLRVWDLRGNLSTQ 1717


>01_01_0911 - 7176355-7176372,7176502-7176756,7177352-7177615,
            7177691-7177810,7177910-7178041,7178136-7178252,
            7178335-7178459,7178611-7178920,7179368-7179550,
            7179643-7179787,7180126-7181355,7181454-7181563,
            7181768-7182037,7182130-7182963
          Length = 1370

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 26/78 (33%), Positives = 36/78 (46%)
 Frame = +2

Query: 83   NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
            NG VT IA    Y   I S   D TL VW+    EN   +  +    H+  I+ + +   
Sbjct: 1085 NGEVTSIAYFKGY---IFSGHSDGTLKVWE--GSENILRLVHES-QEHTKAITSLAVLHS 1138

Query: 263  GNYALSGSWDKTLRLWDL 316
                 SGS D+T+R+W L
Sbjct: 1139 EEKLFSGSLDRTIRVWQL 1156


>05_07_0181 -
           28225396-28225587,28226009-28226068,28226150-28226416,
           28227167-28227232,28228164-28228963,28229565-28229673,
           28230391-28232097
          Length = 1066

 Score = 32.3 bits (70), Expect = 0.32
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           NY  S  +D T++LWD ++G+   +F +H K
Sbjct: 860 NYLASTDYDGTVQLWDASSGQGFTQFTEHRK 890


>01_01_0542 +
           3975500-3975546,3976273-3976370,3976694-3976830,
           3977518-3977871,3977953-3978041,3978502-3978589,
           3978659-3978734,3978858-3978907,3979032-3979340,
           3979803-3979982,3980086-3980325,3980471-3980582,
           3980931-3981040,3981162-3981311,3981777-3981932,
           3982289-3982405,3982759-3982839,3983338-3983478
          Length = 844

 Score = 32.3 bits (70), Expect = 0.32
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 2/78 (2%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKR-LYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           ++ +   DK +++W          + QK  L  HS  I+DV  S       + S+DKT+R
Sbjct: 621 LLATGGHDKKVVLWHAET------LKQKSVLEEHSLLITDVRFSPSIPRLATSSFDKTVR 674

Query: 305 LWDL-AAGKTTRRFEDHT 355
           +WD    G + R F  H+
Sbjct: 675 VWDADNQGYSIRTFTGHS 692



 Score = 32.3 bits (70), Expect = 0.32
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWD--KTLRLWDLAAGKT 331
           +R  GH+  +  V     G Y +S S D  K+L LWD++  +T
Sbjct: 768 RRFEGHTKHVDSVCWDPSGEYVVSVSEDTVKSLELWDMSENRT 810



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 26/97 (26%), Positives = 39/97 (40%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH+  V  +  +P   D+I S   D  +  W +    NN  I +    G S      
Sbjct: 687 TFTGHSASVMSLDFHPNKDDLICSCDGDNEIRFWSI----NNGNIVRIFKGGSSQLRFQ- 741

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                G Y L+ + +  + + D+      RRFE HTK
Sbjct: 742 --PRHGGY-LAVASENAVSILDVETQACLRRFEGHTK 775


>11_01_0699 -
           5757410-5757458,5757760-5757831,5758084-5758152,
           5758329-5758477,5758568-5758699,5758784-5759109,
           5759330-5759399,5759684-5759738,5760322-5760377,
           5760500-5760700,5761466-5761651,5761756-5761906,
           5761978-5762206,5762321-5762582,5762858-5762959
          Length = 702

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGN--YALSGSWDKTLRLWD 313
           L+GH   +S     + GN  Y ++GS DKT R+WD
Sbjct: 559 LFGHGSAVSCFDYFTRGNQQYIITGSLDKTARIWD 593



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 20/61 (32%), Positives = 30/61 (49%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I++ S DKT  +W   +      I    L GH   ++ V    D    L+GS D+T+RLW
Sbjct: 580 IITGSLDKTARIWDC-KSRTCVQI----LIGHMDCVTCVCSHPDLPILLTGSNDETVRLW 634

Query: 311 D 313
           +
Sbjct: 635 N 635


>06_03_1130 - 27826384-27827039,27827800-27828031,27828120-27828491,
            27829243-27829449,27829611-27829704,27829806-27829870,
            27829946-27830398,27830467-27830760,27830837-27831295,
            27831367-27831588,27831755-27831968,27832039-27832494,
            27833280-27833389,27833468-27833644,27833758-27833979,
            27834048-27834167,27834274-27834383,27834552-27834607,
            27835252-27835440,27835602-27835775,27836066-27836281,
            27837066-27837106,27837971-27837986,27838330-27838415,
            27838737-27838910,27839093-27839149,27839720-27840064,
            27840175-27840216,27840377-27840496,27840575-27840724,
            27840830-27841534,27841609-27841954,27842978-27843080,
            27844817-27844860,27845905-27846101,27846322-27846344,
            27846802-27847122,27847406-27847579,27847843-27848047,
            27848817-27848880,27850097-27850278,27850291-27850350,
            27850688-27850748,27851249-27851313,27851491-27851569,
            27851656-27852021,27852442-27852790,27852887-27852989,
            27853103-27853373,27854296-27854405,27854515-27854652
          Length = 3364

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 4/94 (4%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR----LYGHSHF 235
            ++R H   V  +A + +  +++ + S D T+++W   R   +  +  +R      GH   
Sbjct: 3134 SIRQHKDVVACVAVSSR-GNVVATGSYDTTVMIWHAFRGRPSDHVVMERPVHIFCGHDDI 3192

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
            I+ + +S++ +  +SGS D T     L  G+  R
Sbjct: 3193 ITCLFVSTELDIVISGSKDGTCIFHTLREGRYVR 3226


>06_01_0936 - 7220333-7220508,7221208-7221327,7221898-7223089
          Length = 495

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 17/66 (25%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYG-----IPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           ++ S + D++++ W+ +      G     +    L GH+  +  + L++DG+   SGS D
Sbjct: 264 VLYSGACDRSVVAWENSAGAGAGGADVRMVATATLRGHARAV--LCLAADGDVVCSGSAD 321

Query: 293 KTLRLW 310
           +T+R+W
Sbjct: 322 RTVRVW 327



 Score = 29.9 bits (64), Expect = 1.7
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           H   ++ + LS DG    S SWD++L+ W L
Sbjct: 161 HVDAVTALALSPDGESMYSVSWDRSLKAWRL 191


>05_04_0355 -
           20577189-20577275,20578001-20578129,20578252-20578371,
           20578505-20578741,20578983-20579258,20579375-20579508,
           20580006-20581632
          Length = 869

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 22/75 (29%), Positives = 36/75 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + + SRDK++  W L     +Y + +  + GH   +S + ++    Y  SGSWD ++R W
Sbjct: 664 LYTGSRDKSIKAWSL----EDYSL-RCTMTGHKSTVSCLAVACGILY--SGSWDGSIRSW 716

Query: 311 DLAAGKTTRRFEDHT 355
            L         ED T
Sbjct: 717 WLTDHSPLSVLEDGT 731



 Score = 31.5 bits (68), Expect = 0.57
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           + SSS DKT+ VW L +D ++    ++ L GH H I+ +V+  + N +L  S D
Sbjct: 572 LFSSSYDKTINVWSL-QDFSH----KQSLKGHEHKITAIVVVDNDNQSLCISGD 620


>05_04_0022 - 17217626-17217643,17217740-17217856,17217987-17218112,
            17218194-17218340,17218423-17218533,17218625-17218747,
            17218827-17218958,17219157-17219252,17219532-17219653,
            17219833-17220130,17220213-17220458,17220711-17220852,
            17221068-17222105,17222183-17222262,17222558-17222800,
            17222907-17222967,17224059-17224675
          Length = 1238

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            H   ++   LS  G   LSGS DK++R+W +A  K
Sbjct: 999  HKRAVTCFALSDTGENLLSGSADKSIRVWKMAQRK 1033


>03_05_0448 -
           24426509-24426737,24427306-24427401,24427723-24427847,
           24428694-24428846,24429921-24430247,24431415-24431630,
           24431768-24432112,24433897-24434253
          Length = 615

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 21/92 (22%), Positives = 45/92 (48%), Gaps = 1/92 (1%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           ++TL      + H+G V  +A + ++  +  S   D  L++W L    +    P + +  
Sbjct: 405 NKTLDALQIFKYHDGVVEDVAWHLRHEYLFGSVGDDHNLLIWDLRSPVSTK--PVQSVAA 462

Query: 224 HSHFISDVVLSSDGNYAL-SGSWDKTLRLWDL 316
           H   ++ +  +    + + +GS DKT++L+DL
Sbjct: 463 HQGEVNCLAFNPFNEWVVATGSTDKTVKLFDL 494



 Score = 28.3 bits (60), Expect = 5.3
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 10/90 (11%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR------DENNYGIPQKRLY---GHSH 232
           H   V Q+  +PK   ++ S    + L+VW L+R       E+    P + L+   GH+ 
Sbjct: 507 HKEEVFQVGWSPKNETILASCCLGRRLMVWDLSRIDQEQTPEDAEDGPPELLFIHGGHTS 566

Query: 233 FISDVVLSSDGNYAL-SGSWDKTLRLWDLA 319
            ISD   +   ++ + S + D  L++W +A
Sbjct: 567 KISDFSWNPCEDWVIASVAEDNILQIWQMA 596


>03_02_0099 -
           5614007-5614233,5614725-5614998,5615086-5616179,
           5616674-5616772,5617371-5617389
          Length = 570

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +2

Query: 104 ATNPKYPDMI-LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALS 280
           AT  KY D+I + +S+ + LI+     D  +  +           + D+V S DG Y L+
Sbjct: 180 ATFDKYGDLIYVGNSKGEILII-----DSKSIKVHAVIPIPGGTVVKDIVFSRDGRYLLT 234

Query: 281 GSWDKTLRLWD 313
            S D+ +R++D
Sbjct: 235 NSNDRVIRVYD 245


>01_05_0439 - 22159425-22159520,22160137-22160345,22161028-22161066,
            22161196-22161356,22161447-22161518,22162002-22162183,
            22162580-22162703,22164196-22164299,22165526-22165725,
            22165838-22166069,22166156-22166239,22166329-22166386,
            22166724-22166771,22167924-22168081,22168451-22168501,
            22168585-22168658,22168760-22168835,22169685-22169729,
            22169833-22169899,22169978-22170095,22170580-22170775,
            22171551-22171640,22171985-22172039,22172755-22172975,
            22173362-22173454,22173608-22173721,22173918-22173981,
            22174081-22174181,22174306-22174447,22174528-22174729,
            22174883-22174976,22176172-22176348
          Length = 1248

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 25/85 (29%), Positives = 36/85 (42%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH  W+  +       + I++ S D T  VW LTR     G     L  H+  I  V 
Sbjct: 1073 LQGHTKWIRSMRMTG---ETIITGSDDWTARVWSLTR-----GTCDAVLACHAGPILCVE 1124

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAG 325
             S      ++GS D  +R W+   G
Sbjct: 1125 YSPSDKGIITGSSDGLIRFWENEGG 1149



 Score = 29.9 bits (64), Expect = 1.7
 Identities = 25/106 (23%), Positives = 47/106 (44%), Gaps = 2/106 (1%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE--NNYGIPQKRLY 220
            +T KL   L+GH+  V+ +       + +L++S D T+ +W +  D      G  Q  + 
Sbjct: 982  QTFKLLEELKGHDAPVSSVRMLSG--ERVLTASHDGTVKMWDVRTDTCVATVGRCQSAVL 1039

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
               +  S  +L++ G        D    +WD+ + K   + + HTK
Sbjct: 1040 CMEYDDSTGILAAAGR-------DVVAHVWDIRSSKQMFKLQGHTK 1078


>10_08_0810 +
           20734490-20734606,20735182-20735433,20735521-20735664,
           20735774-20736493,20736955-20737177,20737463-20737523,
           20738294-20738615
          Length = 612

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 14/45 (31%), Positives = 26/45 (57%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++L  H+  ++ V  ++DG+  +SGS D+ + LWD   G    +F
Sbjct: 49  RKLNRHTGCVNTVGFNADGDTLISGSDDQMVMLWDWDTGAIKLQF 93


>07_03_1101 +
           23967298-23967366,23968918-23969021,23969616-23969716,
           23969792-23969858,23969910-23970045,23970470-23970583,
           23970649-23970786,23970865-23970949,23971029-23971075,
           23971216-23971351,23971396-23971436
          Length = 345

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           S DGN+ +SGS D ++  W++ +GK  R
Sbjct: 263 SPDGNHIISGSGDGSVYAWNVRSGKVAR 290



 Score = 27.5 bits (58), Expect = 9.2
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           Q+R+      +  + L S+    LSGS D+T+ LWD
Sbjct: 117 QQRILSVLIRVVSISLCSENGNILSGSLDRTVLLWD 152


>07_01_1005 +
           8509777-8509968,8510059-8510205,8510326-8510544,
           8510652-8510761,8511337-8511391,8511447-8511631,
           8512537-8512599,8513713-8513782,8514159-8514242,
           8515925-8516159,8516213-8516517
          Length = 554

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 20/82 (24%), Positives = 39/82 (47%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           HN  V   A +P    ++ ++S D T  +W+ +  +         L GH + +  V  S+
Sbjct: 71  HNRTVRSCAWSPD-GKLLATASFDSTTAIWEYSGGDFEC---VATLEGHENEVKSVSWSA 126

Query: 260 DGNYALSGSWDKTLRLWDLAAG 325
            G+   + S DK++ +W++  G
Sbjct: 127 SGSLLATCSRDKSVWIWEMQPG 148


>07_01_0853 + 6982185-6983593,6985926-6986497,6987139-6988439
          Length = 1093

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
           + ++  D  L  W +  +   +  P      H  +I     S +D N   +GS+D+ ++L
Sbjct: 153 LFTAGDDALLAYWDVPSETPVFAAPA----AHRDYIRAGAASPADHNIFATGSYDRIVKL 208

Query: 308 WDLAAGKTT 334
           WD   GKT+
Sbjct: 209 WDARMGKTS 217


>06_03_0482 +
           21307314-21307458,21308747-21308850,21308924-21309019,
           21309264-21309383,21310049-21310246,21310392-21310483,
           21310848-21310966,21311722-21311845,21312016-21312139,
           21312998-21313066,21313146-21313237,21313330-21313407,
           21313677-21313744,21313842-21313978
          Length = 521

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ISD+  S DG Y LS  +  TL+LWDL
Sbjct: 353 ISDIKFSRDGRYILSRDY-MTLKLWDL 378


>03_06_0560 + 34726338-34727243
          Length = 301

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVWK 172
           +L  TL GH G V ++A  +PK+  ++ S   D  ++VWK
Sbjct: 48  QLLATLSGHYGPVWRVAWAHPKFGSILASCGYDGRVVVWK 87


>03_05_0373 + 23581812-23583293
          Length = 493

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 27/93 (29%), Positives = 41/93 (44%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L   LR     VT IA + +   + + SS D  +  W     E  YG   +     +H  
Sbjct: 310 LETVLREDESAVTAIAVSAEGRVVYVGSS-DGDVTYWHWIDGEARYGGALR-----AHGT 363

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           + + L+  GN  +SGS D+TL  W    G+ +R
Sbjct: 364 AVMCLAVAGNVVVSGSADRTLCAWRRGGGEHSR 396


>02_02_0663 -
           12740733-12741104,12741260-12741326,12741709-12741809,
           12741852-12742273,12743678-12743685,12745164-12745396
          Length = 400

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           H+  + DV  S +G   LSG +D +LRL D+  GK  + F++   V
Sbjct: 91  HTAAVKDVRWSLNGLSLLSGGFDCSLRLVDVEEGKEIKVFKEDQAV 136



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +2

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           S+ N  LSG    +LRLWD+ +G  T+ ++
Sbjct: 144 SNSNLFLSGGSKGSLRLWDIRSGLVTKEYQ 173


>01_07_0014 -
           40455673-40455723,40455815-40455892,40455987-40456049,
           40456250-40456390,40456851-40456949,40457403-40457477,
           40457556-40457652,40457738-40457805,40458456-40458512,
           40458613-40458671,40458798-40458921,40459208-40459264,
           40459378-40459457,40459585-40459793,40459868-40459986
          Length = 458

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 1/83 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   V  +A N +  +++ S+S DKT+ +W +     + G     L  H   +  V  S 
Sbjct: 244 HRSSVLGLAWNKEVRNVLASASADKTVKIWDV-----SVGKCAVTLEHHDDKVQSVAWSR 298

Query: 260 DG-NYALSGSWDKTLRLWDLAAG 325
                 LSGS+DK++ + D+  G
Sbjct: 299 QSPEVLLSGSFDKSVAMNDMKDG 321



 Score = 30.7 bits (66), Expect = 0.99
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           N   S S DKT+++WD++ GK     E H
Sbjct: 259 NVLASASADKTVKIWDVSVGKCAVTLEHH 287


>12_02_0971 + 24949137-24950534
          Length = 465

 Score = 31.1 bits (67), Expect = 0.75
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 7/93 (7%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           G LRGH   V  +A   +   +++S S D+T+ VW+  R+E         L GH+  +  
Sbjct: 339 GALRGHRMAVLCLAVAGR---VVVSGSADRTISVWR--REEGADHARLAVLAGHTGPVKC 393

Query: 245 VVLSSDGNYA-------LSGSWDKTLRLWDLAA 322
           V +  + + A        SGS D ++++W +++
Sbjct: 394 VAMDEEDDTAGDKRWVVYSGSLDGSVKVWRVSS 426



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 12/43 (27%), Positives = 20/43 (46%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           H   +S + L +      SGSWDKT ++W ++  +       H
Sbjct: 203 HFDAVSCLSLDAAAGLLYSGSWDKTFKVWRVSDSRCLESVRAH 245


>07_03_1570 +
           27797315-27797409,27797519-27797551,27798135-27798199,
           27798406-27798493,27798579-27798651,27798975-27799081,
           27799595-27799637,27799760-27799816,27799905-27799981,
           27800221-27800266,27800364-27800410,27800498-27800571,
           27800656-27800711,27800885-27801011,27801133-27801206
          Length = 353

 Score = 31.1 bits (67), Expect = 0.75
 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = +2

Query: 224 HSHF-ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           HS + I  +  S+D NY  S S DK L+LWDL
Sbjct: 260 HSEYPIEALAFSNDRNYLGSISHDKMLKLWDL 291


>07_03_0153 -
           14481421-14481506,14481933-14482111,14483046-14483130,
           14483301-14483499,14484222-14484292,14484380-14484486,
           14484571-14484703,14484870-14485020,14485147-14485249,
           14485330-14485438,14485587-14485746,14486293-14486394,
           14486892-14487009,14487596-14487750,14487850-14487948,
           14488078-14488167
          Length = 648

 Score = 31.1 bits (67), Expect = 0.75
 Identities = 11/36 (30%), Positives = 22/36 (61%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           GH+  +  + + + G +  SGS D T+R+W++  G+
Sbjct: 343 GHNGPVKSLSVEATGQWIASGSSDGTIRVWEVETGR 378


>06_02_0064 +
           11062798-11063568,11064212-11064261,11064354-11064510,
           11064598-11064816,11065301-11065429,11066502-11068031,
           11068654-11069013,11069086-11069205,11069727-11069897,
           11070022-11070180,11070327-11070452,11070660-11070968
          Length = 1366

 Score = 31.1 bits (67), Expect = 0.75
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           LR  LRGH   VT +A   +    + S+S D  + VWK+    +    PQ
Sbjct: 248 LRSLLRGHTQRVTDMAFFAEDVHRLASASVDGRIYVWKIDEGPDEQNKPQ 297


>03_02_0702 +
           10526895-10526958,10527141-10527284,10528028-10528116,
           10528246-10528780,10528909-10529076,10529728-10529906,
           10530028-10530107,10530205-10530313,10530406-10530507,
           10531329-10531403,10531499-10531606,10532395-10532596,
           10532765-10533060
          Length = 716

 Score = 31.1 bits (67), Expect = 0.75
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALS-GSWDKTLRLWDLAAGKT 331
           ++  GH   +  +V S D  Y LS G  ++ + +W L +GKT
Sbjct: 93  QKFSGHPVAVRSMVFSGDSQYVLSSGVGERYVAIWKLGSGKT 134


>01_07_0350 +
           42941976-42942401,42942510-42942737,42943201-42943380,
           42943515-42943730,42943854-42943955,42944377-42944439,
           42944526-42944594,42945662-42945730,42947003-42947069,
           42947449-42947514,42947600-42947697,42947820-42947857,
           42947929-42948016,42948101-42948373,42948470-42948535,
           42948624-42948779
          Length = 734

 Score = 31.1 bits (67), Expect = 0.75
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           L GH+  +  + +S DG   ++G+ D+TLR W++     T+
Sbjct: 388 LTGHTLRVLYLAMSPDGQTIVTGAGDETLRFWNIFPSMKTQ 428


>03_05_1096 - 30364144-30365310,30365825-30365971,30366087-30366393,
            30366541-30366849,30367544-30370567,30370640-30372290,
            30372373-30373463,30373544-30373646,30373737-30374439,
            30374654-30375783,30375913-30376027,30376504-30376695,
            30377443-30377616,30378438-30378494,30378581-30378716,
            30378842-30378927,30379023-30379092,30379993-30380021,
            30380444-30380456,30380762-30381006
          Length = 3582

 Score = 30.7 bits (66), Expect = 0.99
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLI-VWKLTRDENNYGIP-QKRLYGHSHFISDVVL 253
            H G   Q  T   +   IL++  D  ++ VW+  +D     +  +K L  H+  I+ + +
Sbjct: 3332 HGGSQIQ-CTGVSHDGNILTTGGDDGVVAVWRFFKDGTRRLLRMEKALCAHTAKITCIYV 3390

Query: 254  SSDGNYALSGSWDKTLRLWDLAA 322
            S   +  +SGS D ++ LWDL +
Sbjct: 3391 SQPYSLIVSGSDDCSVILWDLTS 3413


>08_02_0632 +
           19515234-19515374,19515489-19515656,19518907-19518993,
           19519551-19519685,19519778-19519882,19519968-19520059,
           19520147-19520252,19520320-19520424,19520516-19520929
          Length = 450

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/34 (41%), Positives = 17/34 (50%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH  +        DGN   +GS D T RLWD+
Sbjct: 318 LKGHLDYSFASAWHPDGNILATGSQDTTCRLWDI 351


>08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,
            3661975-3662133,3662193-3662243,3662838-3663018,
            3663102-3663228,3663322-3663431,3663529-3663667,
            3663767-3663876,3664002-3664071,3664247-3664320,
            3664458-3664553,3664682-3664777,3665041-3665168,
            3665422-3665656,3665743-3665910,3666274-3666381,
            3666468-3666617,3666905-3667015,3667118-3667297,
            3667427-3667555,3667819-3667914,3668108-3668293,
            3668431-3668603,3668720-3668921
          Length = 1150

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 22/89 (24%), Positives = 38/89 (42%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T K+  T        T +A +P+  ++I     D T+ ++ +  DE      + +L GHS
Sbjct: 887  TFKVMTTFMAPPPAATFLAFHPQDNNIIAIGMEDSTIQIYNVRVDE-----VKSKLKGHS 941

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDL 316
              I+ +  S   N  +S   D  L  W +
Sbjct: 942  KKITGLAFSQSMNMLVSSGADAQLCAWSI 970


>08_01_0253 +
           2072766-2072954,2073526-2073591,2073755-2073877,
           2073913-2074017,2074555-2074635,2074715-2074807,
           2075023-2075098,2075182-2075261,2075359-2075430,
           2075553-2075612,2075775-2075871,2076137-2076200,
           2076303-2076362,2076539-2076608
          Length = 411

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 11/36 (30%), Positives = 22/36 (61%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           T  GH   + +I T    P +I+S+S+D+++ +W +
Sbjct: 162 TFVGHGDSINEIRTQALKPSLIISASKDESVRLWNV 197


>07_03_1163 -
           24439976-24440023,24440562-24440597,24440932-24441018,
           24441349-24441492,24441782-24441916,24442215-24442279,
           24442395-24442477,24442607-24442642,24443343-24443449,
           24443558-24443658,24443750-24443909
          Length = 333

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           GH+  +S V    +     S SWD ++R WD+  GK T
Sbjct: 238 GHTQCVSAVTWP-ERQTIYSASWDHSVRQWDVQTGKET 274


>07_01_0745 +
           5691926-5692095,5692654-5692735,5693256-5693334,
           5693452-5693543,5693895-5693982,5694099-5694208,
           5694399-5694515,5694883-5695034,5699134-5699229,
           5699308-5699383,5699481-5699534
          Length = 371

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +2

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           ++ +G    SGS D T++LWD+A+   T + +D
Sbjct: 296 MTCEGALLASGSADCTVKLWDVASSTKTLKMDD 328


>06_02_0200 -
           12946139-12946282,12947636-12947842,12949506-12949629,
           12950167-12950369,12950922-12951620,12951723-12951784,
           12952395-12952404,12954905-12957631
          Length = 1391

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 11/17 (64%), Positives = 15/17 (88%)
 Frame = +2

Query: 275 LSGSWDKTLRLWDLAAG 325
           +SGS+D T+R+WDL AG
Sbjct: 541 ISGSFDSTIRVWDLDAG 557


>04_04_0751 - 27769616-27769684,27769795-27769917,27769998-27770770,
            27771407-27771773,27772104-27772217,27772307-27772403,
            27772968-27773088,27773168-27773252,27773349-27773498,
            27773630-27773746,27773819-27773905,27773981-27774049,
            27774125-27774181,27774266-27774349,27774477-27774513,
            27774721-27774869,27776053-27776538,27776743-27776886,
            27776961-27777509,27778332-27778526,27779226-27779310,
            27779570-27779670,27779689-27780360,27781101-27781433,
            27781957-27782038,27782258-27782334,27782713-27782817,
            27783810-27783944,27784437-27785159,27785882-27786663,
            27787480-27789187
          Length = 2891

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +2

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            GH   ++ + LS D NY ++GS D T+ LW
Sbjct: 2594 GHLAPVTCLALSHDSNYLVTGSRDTTVILW 2623


>03_04_0228 -
           18989688-18989807,18990300-18990345,18990452-18990552,
           18990624-18990702,18990788-18990868,18991440-18991502,
           18994171-18994246,18994980-18995246,18995994-18996076,
           18996792-18996922,18997043-18997174
          Length = 392

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           IS++  S+  ++ L  SWDKT+RL+D  A
Sbjct: 25  ISNLRFSNHSDHLLVSSWDKTVRLYDADA 53



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = +2

Query: 194 YGIPQKRLYG-HSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +G  ++ L G H   +  V  S      ++GSWDKT++ WD
Sbjct: 91  FGSAKEDLLGRHDAPVRCVEYSYAAGQVITGSWDKTIKCWD 131


>03_03_0181 +
           15162681-15162806,15164026-15164172,15164269-15164355,
           15165659-15165793,15165883-15165987,15166079-15166170,
           15166259-15166364,15166463-15166549,15166653-15167084
          Length = 438

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/44 (29%), Positives = 21/44 (47%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++  G    RL GH  +        DG    +G+ D+T R+WD+
Sbjct: 290 DSQSGKEMARLKGHLDYSFSSAWHPDGRVVATGNQDRTCRVWDV 333


>02_05_0568 -
           30034280-30034393,30034888-30035163,30035246-30035371,
           30035595-30035753,30035893-30036063,30036374-30036493,
           30036565-30036924,30038800-30039686,30039790-30040363,
           30041379-30041507,30042423-30042494,30042572-30042728,
           30042974-30043023,30043569-30044327
          Length = 1317

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           LR  LRGH   VT +A   +    + S+S D  + VWK+    +    PQ
Sbjct: 244 LRSLLRGHTQRVTDMAFFAEDVHRLASASVDGRIYVWKIDEGPDEDSKPQ 293


>02_01_0790 +
           5925048-5925165,5926133-5926268,5926832-5926913,
           5927772-5927947,5928594-5928680,5928817-5928956,
           5929546-5929784
          Length = 325

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD--MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           GH+  V  +  +P  PD   ++S+S+D   ++        + G       GH   +    
Sbjct: 14  GHSRPVVDLFYSPVTPDGCFLISASKDSNPMI-----RNGDTGDWIGTFEGHKGAVWSCC 68

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           L ++   A SGS D + ++WD   G+    FE
Sbjct: 69  LDTNALRAASGSADFSAKVWDALTGEELHSFE 100


>06_03_0662 -
           23229957-23230204,23231021-23231160,23231257-23231394,
           23231501-23231676,23232071-23232152,23233531-23233666,
           23237028-23237145
          Length = 345

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 2/92 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD--MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           GH+  V  +  +P  PD   ++S+S+D   +   L   E    I      GH   +    
Sbjct: 14  GHSRPVVDLFYSPVTPDGYFLISASKDGNPM---LRNGETGDWIGT--FQGHKGAVWSCC 68

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           L ++   A SGS D + ++WD   G     FE
Sbjct: 69  LDTNALRAASGSADFSAKVWDALTGDELHSFE 100


>02_05_0559 -
           29953309-29953722,29953852-29953938,29954280-29954385,
           29954468-29954559,29955187-29955438
          Length = 316

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 15/41 (36%), Positives = 19/41 (46%)
 Frame = +2

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           N G     L GH  +      S DG    +G+ DKT R+WD
Sbjct: 176 NSGKTLHSLKGHFDYSFASAWSPDGRTFATGNQDKTCRIWD 216


>05_06_0264 +
           26756337-26756411,26756494-26756594,26757196-26757369,
           26757449-26757548,26757869-26758006,26758104-26758185,
           26758631-26758680,26758748-26758873
          Length = 281

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++   + DG Y +SGS D TL  W++
Sbjct: 210 TEAAFTPDGQYVISGSGDGTLHAWNI 235



 Score = 27.9 bits (59), Expect = 7.0
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH   +  + +S   +  +SGS D ++R+WDL
Sbjct: 113 GHKDRVVSLCMSPVNDSFMSGSLDHSVRIWDL 144


>01_07_0161 + 41574749-41576044
          Length = 431

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +2

Query: 278 SGSWDKTLRLWDLAAGKTTRRFEDH 352
           SGSWDKTL++W ++  K       H
Sbjct: 203 SGSWDKTLKVWRISDLKCLESIHAH 227


>09_02_0022 +
           3065644-3065953,3066048-3067162,3067261-3067437,
           3067535-3067648,3068614-3068718,3068930-3069064,
           3069148-3069203,3069277-3069382,3069515-3069631,
           3069705-3069831,3069915-3070141,3070164-3070727
          Length = 1050

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 25/111 (22%), Positives = 47/111 (42%), Gaps = 2/111 (1%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A+G     K  + +  T+     L+GH G VT ++ +P+  D + S     T+I W L  
Sbjct: 132 AAGDDDGIKLIATIDNTISK--VLKGHKGSVTGLSFDPR-NDYLASIDTFGTVIFWDLCT 188

Query: 182 DENNYGIPQ-KRLYGHSHFISDVVL-SSDGNYALSGSWDKTLRLWDLAAGK 328
                 + +    +G  H I++ +  S DG +         + ++D   G+
Sbjct: 189 GTEARSLKRIAPTFGSDHSINNALCWSPDGQFLAVPGLRNNVVMYDRDTGE 239


>07_01_0057 +
           431084-431105,431149-431297,431380-431526,431622-431752,
           431791-431894,432949-433128,433481-433581,434030-434185,
           434679-434731,434818-434875,435162-435282,436010-436215
          Length = 475

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +2

Query: 245 VVLSSDGNYALSGSWDKTLRLWDL 316
           VVLSSD +Y L  S D +++L+DL
Sbjct: 350 VVLSSDEHYFLGSSMDGSIKLFDL 373


>06_03_0306 - 19396423-19397112,19397645-19397916,19398047-19398215
          Length = 376

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = -2

Query: 494 LLQHKHNLLPRKGTKHWSSASHRHLGLSSVHNQHL 390
           LL H H+  P     H  +A H+H G    H+ HL
Sbjct: 179 LLHHHHHPFP-PAQLHGGAADHKHDGAGGHHHHHL 212


>03_06_0704 +
           35641774-35642031,35642122-35642446,35642546-35642699,
           35643662-35643706,35644121-35644180,35644532-35644694,
           35645356-35645717,35645985-35646303
          Length = 561

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 23/82 (28%), Positives = 35/82 (42%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
           G +  I   P      ++   D  +I+W+   D  N+    K L  HS  +  V      
Sbjct: 349 GIINNINFMPWSDVCFVTGGSDHAVILWQEKDDSWNHKKVHKDL--HSSAVMGVAGLQQK 406

Query: 266 NYALSGSWDKTLRLWDLAAGKT 331
           +  LS   DK +  +DLAAG+T
Sbjct: 407 STILSVGSDKRIISFDLAAGRT 428


>03_05_1065 +
           30061588-30061883,30061995-30062056,30062196-30062276,
           30062391-30062464,30062547-30062629,30063044-30063147,
           30063526-30063665,30063736-30063783,30063939-30063991,
           30064178-30064262,30064346-30064412,30064496-30064606,
           30065262-30065283,30066244-30071110,30071186-30071374,
           30071463-30071577,30072329-30073388,30074247-30074694,
           30074966-30075019,30075105-30076898,30076989-30077949,
           30078271-30078384,30078459-30078613,30078934-30079026,
           30079341-30079613,30093423-30093975,30094465-30094540,
           30094619-30094718
          Length = 4025

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 1/81 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           G  G ++ I+ +P +  M+   S  +T  V+  +  E     P   L+G    ++ V+ S
Sbjct: 231 GPTGIISSISFSP-HNGMLAVGSYSQTTAVYAESNME-----PLYVLHGQLGGVTQVLFS 284

Query: 257 SDGNYALSGS-WDKTLRLWDL 316
            DGNY  +G   D  +  WD+
Sbjct: 285 KDGNYLYTGGRKDPYILCWDI 305


>12_02_1112 + 26162188-26162877,26163263-26163634
          Length = 353

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +2

Query: 278 SGSWDKTLRLWDLAAGKTTRRFED 349
           +G  ++ +  WDL++GK T R ED
Sbjct: 236 TGGEERGITAWDLSSGKVTSRIED 259


>03_05_1069 + 30118930-30120120
          Length = 396

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 18/77 (23%), Positives = 37/77 (48%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+  V+ ++       ++ S S D+T  VW++     N     + +  H   ++ +V + 
Sbjct: 132 HSDAVSCLSPTDSAQGLLYSGSWDRTFKVWRI-----NDSKCLESVVAHDDNVNAIVAAF 186

Query: 260 DGNYALSGSWDKTLRLW 310
           DG    +GS D T+++W
Sbjct: 187 DG-LVFTGSADGTVKVW 202


>03_01_0082 +
           653041-653137,653219-653496,653596-653689,653804-653886,
           654027-654247,654395-654533,654628-654710,654824-655036,
           655099-655494,655587-655758,656085-656276,656363-656569,
           656661-656753,656957-657156,657329-657838,658114-658184,
           658322-658963,659057-659207,659425-659665
          Length = 1360

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVV-LSSDGNYALSGSWDKTLRLWDLA 319
           ++RL G  H++ D   L +DG  A+ G  D ++ LWDL+
Sbjct: 108 EQRLPGFDHWVLDACFLEADGLLAI-GLSDNSVALWDLS 145



 Score = 27.9 bits (59), Expect = 7.0
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           RL  H   I  +  SSDG+  +S S D++ R+W L++
Sbjct: 230 RLKEHEGSIFRIAWSSDGSKFMSVSDDRSARIWMLSS 266


>02_05_0420 +
           28821717-28821854,28821944-28822210,28822299-28822568,
           28822656-28823246,28823336-28823479
          Length = 469

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 9/54 (16%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL-------AAGKT--TRRFEDHT 355
           GHS  +  +  S  G    SG  D  L +WD+       +AG+     R EDHT
Sbjct: 273 GHSQEVCGLKWSGSGQQLASGGNDNLLHIWDVSMASSVPSAGRNQWLHRLEDHT 326


>02_05_0076 +
           25637752-25639062,25639221-25639297,25640962-25641095,
           25641178-25641242,25641431-25641482,25641912-25641994,
           25642128-25642221,25642332-25642861
          Length = 781

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 17/56 (30%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDK 295
           +LSSS DKT+ +W ++   + Y +   + + HS +++ +  +  +  Y +SGS DK
Sbjct: 479 LLSSSMDKTVRLWHVS---STYCL---KTFSHSDYVTCIQFNPVNDKYFISGSLDK 528


>01_06_0102 -
           26447286-26448107,26448248-26448385,26448990-26449359,
           26449505-26449606,26449696-26449788,26449934-26450181,
           26451088-26451274,26451825-26452043,26452464-26452660,
           26453545-26453875,26454099-26454457,26455141-26455240,
           26455349-26455464,26455547-26455663,26455782-26455880,
           26456057-26456131,26456205-26456286,26457724-26457763,
           26458685-26458769,26458924-26459055
          Length = 1303

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 6/101 (5%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMI--LSSSRDKTLIVWKLTR-DENNYGIPQKRLYGHSHFISDV 247
           GH G ++ + T       +  +S   D  LI+W      ++   +P+  L  H   +  V
Sbjct: 121 GHKGAISCLMTFMSAAGEVHLVSGGSDGLLILWSADHIHDSRELVPKISLKAHDGGVVAV 180

Query: 248 VLS---SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            LS         ++   DKTL +WD    K  RR +   K+
Sbjct: 181 ELSRVMGSAPQLITIGADKTLAIWDTVTFKEIRRIKPVPKL 221


>07_03_1093 +
           23912303-23912467,23912671-23912801,23913079-23913087,
           23913146-23913228,23914494-23914596,23915988-23916066,
           23916174-23916274,23916371-23916479
          Length = 259

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           +S +  S   +  L  SWDKT+RL+D  A
Sbjct: 36  VSSLRFSKHSDRLLVSSWDKTVRLYDAEA 64


>06_01_0218 +
           1647624-1647757,1648044-1648112,1648493-1648549,
           1648768-1648934,1649661-1649716,1650319-1650490,
           1650747-1650810,1651037-1651119,1651243-1651334,
           1652028-1652134,1652398-1652461,1652630-1652770
          Length = 401

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 15/36 (41%), Positives = 18/36 (50%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           HS   + V  SSD     S S D T+ LW+L   KT
Sbjct: 352 HSASCNAVTFSSDSKLLASCSADTTVALWELYPPKT 387


>05_03_0376 -
           13252220-13252354,13252433-13252541,13253279-13253337,
           13253608-13253700,13254078-13254153,13254405-13254467,
           13254535-13254629,13254743-13254845,13254930-13255024,
           13255098-13255156,13255445-13255656,13256090-13256222,
           13256691-13257081
          Length = 540

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           Q+   GH+  IS    S+ G+   S S D T+R+W
Sbjct: 265 QETFLGHNSSISCCRFSASGSNVASSSVDGTVRIW 299


>06_03_0541 -
           21944696-21944851,21944939-21945142,21945438-21947472,
           21947644-21947720,21948289-21948477,21949188-21949448,
           21949527-21949632,21951330-21951517,21951814-21951971,
           21952015-21952840,21952947-21953210
          Length = 1487

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 14/54 (25%), Positives = 22/54 (40%)
 Frame = +3

Query: 222 VIRTSFLMLCCLVTVITPFPVLGTRLCVCGISLQARLPDDSRTILRCDRTLNFV 383
           ++R   L   C +  + P P+L   L    + L    P  +  IL C R +  V
Sbjct: 587 LVRMGILPRICFLLEMDPHPILEDNLVSILLGLARHSPQSADAILNCPRLVQSV 640


>01_05_0495 + 22705697-22705765,22705903-22706025,22708429-22708586,
            22709162-22709206,22709367-22709445,22709522-22709595,
            22709703-22709809,22711116-22711301,22711882-22711920,
            22712020-22712086,22712207-22712281,22713113-22713347,
            22713425-22713755,22714530-22714710,22714810-22714950,
            22715041-22715302,22715503-22715892,22717179-22717735,
            22718421-22718557,22718672-22718853,22718959-22719339,
            22719420-22719545,22719635-22719700,22720056-22721839,
            22721914-22722193,22722386-22722616,22723067-22723588,
            22723683-22723815,22723937-22724193
          Length = 2405

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 10/111 (9%)
 Frame = +2

Query: 14   SSLFKPFSKMSETLKLRGTLRGHN--GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
            SSLF  F  MS++ KL   L  HN    +  I T  K    I S + +    + KL  D 
Sbjct: 946  SSLFSCFMAMSQSPKLASLLGAHNLVPAIFSILTVKKASGSITSYALEFIENLIKLDTDL 1005

Query: 188  NNYG--IPQKRLYGHS----HFISDVVLSSDGNYALSGSW--DKTLRLWDL 316
              +G    +K L  H     H ++D V      +  SG+W   + LRL+ L
Sbjct: 1006 EQHGDHSLKKILVPHMDVLLHSLNDFVSYRRELHRKSGTWLGQRELRLFKL 1056


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,396,139
Number of Sequences: 37544
Number of extensions: 302407
Number of successful extensions: 1209
Number of sequences better than 10.0: 151
Number of HSP's better than 10.0 without gapping: 856
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1138
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1525730988
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -