SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A08
         (614 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_05_0161 - 18757122-18757331,18757931-18758488                       31   0.55 
01_01_0145 + 1327172-1327362,1327491-1328169                           30   1.7  
05_01_0316 + 2476689-2477030,2477164-2477283,2477742-2477819,247...    29   2.9  
01_04_0102 + 16030094-16030462,16030595-16030714,16031715-160317...    28   6.8  
05_03_0066 + 7980038-7981468                                           27   8.9  

>01_05_0161 - 18757122-18757331,18757931-18758488
          Length = 255

 Score = 31.5 bits (68), Expect = 0.55
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = -1

Query: 200 LPGPCPHVVANSLTSVQPLNNGYT*FLES 114
           LP P PHV++N +  +Q L N YT  L S
Sbjct: 180 LPRPTPHVISNIIKIMQNLRNAYTLALPS 208


>01_01_0145 + 1327172-1327362,1327491-1328169
          Length = 289

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = -3

Query: 390 SPEIQSICSLW-DRACPRCTKPLGIPRVR 307
           +P      S W DRACP C +P+G  R R
Sbjct: 69  TPRAAPAASSWMDRACPSCNEPIGDIRCR 97


>05_01_0316 +
           2476689-2477030,2477164-2477283,2477742-2477819,
           2477956-2478132,2478317-2478394,2478694-2478866,
           2478994-2479149,2479573-2479633,2479831-2480049
          Length = 467

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 16/53 (30%), Positives = 25/53 (47%)
 Frame = -3

Query: 441 AELLCTDFEEAALGLSVSPEIQSICSLWDRACPRCTKPLGIPRVRNPHIDPIS 283
           A++    F + +  L  S    ++C +WDR C    KP G   V   H+D I+
Sbjct: 240 ADVNAVTFADESGNLLYSGSDDNLCKVWDRRCLAREKPAG---VLTGHLDGIT 289


>01_04_0102 +
           16030094-16030462,16030595-16030714,16031715-16031792,
           16032760-16032933,16033844-16033921,16034338-16034510,
           16034757-16034912,16036460-16036621,16036815-16036826,
           16036947-16036962,16037663-16037875
          Length = 516

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = -3

Query: 441 AELLCTDFEEAALGLSVSPEIQSICSLWDRACPRCTKPLGIPRVRNPHIDPIS 283
           A++    F +    +  S    S+C +WDR C +  K +G   V   H+D I+
Sbjct: 248 ADVNAVTFADEGSDVLYSGSDDSLCKVWDRRCNKRGKQVG---VLTGHLDGIT 297


>05_03_0066 + 7980038-7981468
          Length = 476

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = -2

Query: 157 QFSHSITVTLDFWNLALRSSDVLTRSMKEKQMKSWHTVT 41
           +F   + +TL  +  A ++  VL R +KEK+++S  TVT
Sbjct: 371 RFEGQLALTLLHYGNAGKAKKVLDRKLKEKKVESNSTVT 409


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,613,201
Number of Sequences: 37544
Number of extensions: 311698
Number of successful extensions: 941
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 926
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 941
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1478421500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -