SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A06
         (414 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0976 + 12841257-12841306,12841396-12841528,12842126-12842191     55   3e-08
03_05_0610 - 26108546-26108671,26108739-26108789,26109410-261095...    53   8e-08
02_05_1349 + 35841694-35843738,35844506-35844624,35844932-358450...    31   0.48 
06_01_1174 - 10025086-10027217,10027271-10027333,10027704-10027866     27   4.5  
02_02_0739 - 13560241-13560622,13561192-13561239,13563727-13564949     27   5.9  

>03_02_0976 + 12841257-12841306,12841396-12841528,12842126-12842191
          Length = 82

 Score = 54.8 bits (126), Expect = 3e-08
 Identities = 23/31 (74%), Positives = 27/31 (87%)
 Frame = +1

Query: 49  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 141
           MQN+ G+ VDLY PRKCSA+NR+I AKDHAS
Sbjct: 1   MQNEEGQMVDLYVPRKCSATNRIITAKDHAS 31


>03_05_0610 -
           26108546-26108671,26108739-26108789,26109410-26109542,
           26109633-26109682
          Length = 119

 Score = 53.2 bits (122), Expect = 8e-08
 Identities = 22/31 (70%), Positives = 26/31 (83%)
 Frame = +1

Query: 49  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 141
           MQN+ G+ VDLY PRKCS +NR+I AKDHAS
Sbjct: 1   MQNEEGQMVDLYVPRKCSTTNRIITAKDHAS 31


>02_05_1349 +
           35841694-35843738,35844506-35844624,35844932-35845075,
           35845189-35845310,35845474-35845609,35845861-35845957,
           35846727-35846899,35847099-35847262,35847466-35847537,
           35847833-35847928,35847999-35848124
          Length = 1097

 Score = 30.7 bits (66), Expect = 0.48
 Identities = 13/28 (46%), Positives = 20/28 (71%)
 Frame = +2

Query: 41  HIKCRTTPVNSLTCTARGNARPATASST 124
           H++CR+TP +SLT     N  PA++SS+
Sbjct: 81  HLRCRSTPRDSLTYNTLLNHLPASSSSS 108


>06_01_1174 - 10025086-10027217,10027271-10027333,10027704-10027866
          Length = 785

 Score = 27.5 bits (58), Expect = 4.5
 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +1

Query: 28  PCGRTYKMQNDAGEFVDLY-CPRKCSASNRLI 120
           P G+  + Q D G  ++L  CP +CS + +L+
Sbjct: 255 PTGKDIQQQRDRGGPIELLVCPSRCSRTKQLV 286


>02_02_0739 - 13560241-13560622,13561192-13561239,13563727-13564949
          Length = 550

 Score = 27.1 bits (57), Expect = 5.9
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = -1

Query: 216 QTTYILDVSAARPVAGSTSAIT-SC-X*SMVLSVDEAVAGR 100
           Q T IL+ +  +P+  STSAIT +C    M+L +D+ V  R
Sbjct: 510 QITNILEENVVQPLLVSTSAITLACECVRMILKIDDIVTVR 550


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,308,243
Number of Sequences: 37544
Number of extensions: 169751
Number of successful extensions: 488
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 475
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 488
length of database: 14,793,348
effective HSP length: 75
effective length of database: 11,977,548
effective search space used: 742607976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -