SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A04
         (587 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_02_0100 - 6783821-6784339,6784815-6784984,6785062-6785164,678...   120   9e-28
06_03_0500 + 21470681-21470952,21471049-21471089,21472322-214724...   116   2e-26
10_08_0338 + 16916429-16916650,16916728-16917900                       96   1e-24
07_03_1061 + 23651404-23651625,23651764-23652954                      107   5e-24
11_06_0497 + 24337772-24337993,24338042-24338083,24338176-24339357    100   2e-21
07_01_0628 - 4691991-4692806,4694291-4694293,4694527-4694637           88   6e-18
01_07_0160 - 41563109-41563468,41563566-41563985,41564082-415642...    81   6e-16
08_02_0181 + 13923658-13923661,13925518-13925681,13925879-139259...    79   3e-15
06_03_0794 - 24671955-24672362,24672469-24672505,24672804-246728...    77   8e-15
03_02_0346 - 7666500-7666646,7666744-7666902                           77   1e-14
01_06_1533 + 38041499-38041681,38041853-38041985,38042816-380429...    77   1e-14
12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732...    75   3e-14
06_01_0824 - 6219477-6219556,6220427-6220808,6221415-6221448,622...    75   4e-14
02_05_0796 + 31800256-31800528,31800635-31800758,31802642-318027...    75   4e-14
08_02_1101 - 24308433-24308978,24309195-24309364,24309443-243095...    75   6e-14
03_05_0630 + 26260159-26260272,26260520-26260894                       74   7e-14
01_06_1799 + 39948481-39948607,39948694-39948762,39948859-399489...    72   4e-13
01_07_0243 + 42240553-42240750,42241114-42241255,42242327-42242442     71   7e-13
01_06_0833 + 32296957-32297256,32299257-32299895                       71   7e-13
12_02_1219 + 27096477-27096590,27096704-27097078                       71   9e-13
07_01_0182 + 1280479-1280754,1281232-1282089                           69   2e-12
03_06_0105 + 31675083-31675313,31676171-31676815                       68   6e-12
01_05_0696 - 24366857-24368200                                         68   6e-12
07_03_1378 + 26158233-26158562,26159075-26159176,26159551-261598...    67   8e-12
02_05_0506 + 29613307-29613601,29613641-29613678,29613679-296138...    67   8e-12
03_06_0587 - 34921535-34922041,34922579-34922689                       65   3e-11
03_02_0613 - 9848514-9848539,9848942-9849200,9849326-9849365,984...    63   2e-10
08_02_1559 - 27873345-27873407,27873549-27873830,27874162-278742...    62   2e-10
04_04_1294 - 32424762-32426309                                         62   2e-10
03_05_0702 - 26934736-26935551,26937494-26937538,26938484-26938594     61   6e-10
03_03_0130 - 14699658-14699723,14699828-14700109,14700444-147005...    59   2e-09
07_03_1175 - 24555965-24556117,24557809-24558264,24558270-245584...    58   7e-09
03_01_0160 + 1302366-1302731,1303318-1303364,1303455-1303800           58   7e-09
09_06_0308 - 22199389-22199451,22199604-22199924,22200178-222004...    57   9e-09
02_05_1206 + 34941293-34941562,34942052-34942153,34942249-349425...    56   2e-08
03_02_0558 - 9459745-9459980,9460089-9460157,9460630-9460846           56   2e-08
03_05_0067 - 20460206-20460703,20461255-20461530                       55   4e-08
10_08_0154 + 15266430-15266953,15267748-15267820,15267893-152679...    54   8e-08
05_01_0112 - 757514-758444,758525-758571,759074-759236,759861-76...    54   8e-08
01_01_1143 - 9064210-9065682                                           54   8e-08
03_02_0555 + 9431451-9431688,9432685-9432803,9432886-9433079,943...    54   1e-07
05_04_0101 - 18003528-18003655,18003951-18003997,18004046-180040...    53   1e-07
04_03_0876 + 20493213-20493339,20493574-20493642,20493745-20493890     53   2e-07
10_05_0029 - 8319233-8319408,8319516-8319584,8319754-8319838,832...    52   3e-07
08_01_0620 - 5416197-5416225,5416333-5416652,5417144-5417235,541...    52   3e-07
03_01_0373 - 2904914-2904949,2905030-2905144,2906446-2906534,290...    52   3e-07
07_03_0824 + 21769569-21769689,21770891-21770959,21771047-217711...    52   5e-07
05_03_0023 + 7457836-7457976,7458313-7458480                           52   5e-07
04_04_1188 + 31579833-31579914,31580001-31580176,31580822-315809...    52   5e-07
03_02_0472 - 8737955-8738580,8738704-8738767,8739090-8739239,873...    52   5e-07
05_03_0025 + 7462272-7462412,7462865-7463032                           50   1e-06
05_03_0022 + 7452234-7452389,7452955-7453113                           50   1e-06
08_01_0118 + 947394-947885,948709-948810,948914-949219,949557-94...    50   1e-06
03_06_0523 + 34499533-34499705,34499808-34499917,34500037-345002...    50   2e-06
10_01_0298 - 3094197-3094307,3095093-3095253,3095462-3095666,309...    49   2e-06
09_04_0424 + 17444261-17444665,17445974-17446367,17447367-174474...    49   3e-06
08_01_0268 - 2167639-2167764,2167887-2167937,2169126-2169167,216...    49   3e-06
11_02_0073 - 8020401-8020512,8020594-8020679,8020761-8020921,802...    48   4e-06
11_01_0236 + 1811822-1812971,1814930-1814979,1815676-1816116,181...    48   4e-06
04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916...    48   4e-06
01_06_0006 - 25517892-25517935,25518156-25518276,25518598-255187...    48   6e-06
12_01_0234 + 1755704-1756120,1756203-1756313,1756923-1757063,175...    48   7e-06
04_04_0979 - 29862280-29862444,29862718-29862999,29863831-298639...    48   7e-06
04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066     48   7e-06
09_02_0211 - 5817564-5817578,5817711-5818040,5818095-5818196,581...    47   1e-05
08_02_0526 + 18184146-18184168,18184247-18184438,18184846-181849...    47   1e-05
07_01_0413 - 3155080-3155274,3155628-3155933,3156062-3156163,315...    46   2e-05
02_04_0289 + 21615745-21616155,21617417-21617870,21618162-216182...    46   2e-05
08_02_0162 + 13464698-13464974,13465719-13465837,13465920-134665...    46   2e-05
09_01_0079 - 1159963-1160211,1160303-1160509,1160631-1160801,116...    46   3e-05
08_02_1064 - 24033941-24034127,24034432-24034476,24035355-240354...    45   4e-05
07_03_0600 + 19866757-19867218,19867920-19868429                       45   4e-05
06_03_0614 - 22753092-22753349,22754059-22754277,22754712-227549...    45   4e-05
04_04_1627 - 34867557-34870095,34870159-34870391,34871274-34871276     45   4e-05
03_01_0293 - 2258647-2258754,2258861-2259085                           45   4e-05
01_04_0003 - 14989160-14989445,14989673-14989807,14991418-149915...    45   4e-05
09_04_0506 - 18188785-18190599                                         45   5e-05
04_04_0435 - 25170348-25170593,25170989-25171189,25171580-251717...    45   5e-05
01_07_0362 + 43063345-43063420,43064176-43064244,43064348-430644...    45   5e-05
08_02_0651 - 19714348-19714395,19715319-19715429,19715503-197155...    44   7e-05
03_03_0192 - 15308602-15308869,15309457-15309528,15310271-153103...    44   7e-05
08_02_1098 - 24291138-24291851,24292607-24292861                       44   9e-05
11_06_0326 - 22382001-22383248                                         44   1e-04
02_01_0251 - 1652356-1652522,1652564-1652608,1652658-1652733,165...    44   1e-04
02_04_0518 + 23601355-23602498,23603481-23603779                       43   2e-04
08_01_0098 - 700443-700660,701112-701268,701586-701678,701763-70...    43   2e-04
02_05_0627 + 30463452-30463774,30463841-30463956,30464125-304643...    43   2e-04
07_03_1316 + 25736931-25737206,25737276-25737329,25738036-257381...    42   3e-04
11_06_0418 - 23317077-23317343,23317614-23317787,23317886-233179...    42   4e-04
08_02_1084 - 24232968-24234779                                         42   4e-04
03_05_0235 - 22214700-22214914,22218782-22219045,22219258-22219294     42   4e-04
09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052,174...    42   5e-04
02_02_0008 + 6061508-6061624,6062468-6062566,6062636-6063039,606...    42   5e-04
10_08_0254 + 16236689-16236793,16237760-16237808,16237988-162380...    41   6e-04
09_06_0188 - 21441377-21442201                                         41   6e-04
08_02_1039 - 23866743-23866862,23866985-23867266,23867868-238679...    41   6e-04
06_03_1455 + 30264023-30264174,30265930-30266070,30266328-302664...    41   6e-04
12_02_0846 - 23623624-23623784,23624076-23624258,23624601-236246...    41   8e-04
07_03_1389 + 26212117-26212119,26212721-26212875,26213402-262134...    41   8e-04
05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-98...    41   8e-04
04_04_0674 + 27173948-27174188,27174704-27175260,27175310-271753...    40   0.001
03_03_0117 - 14583102-14583186,14585202-14585336,14585440-145856...    40   0.001
02_02_0387 - 9606744-9607475                                           40   0.001
02_02_0284 - 8547126-8547187,8547306-8547395,8547810-8547861,854...    40   0.001
02_02_0238 + 8163922-8164362,8165008-8165118,8165205-8165249,816...    40   0.001
05_04_0092 + 17851085-17851346,17852778-17852860,17853891-178539...    40   0.002
04_04_1223 + 31851545-31852609,31854314-31854773,31856201-318562...    40   0.002
02_04_0661 - 24802868-24802921,24803004-24803089,24803178-248032...    40   0.002
01_07_0120 + 41185884-41186127,41187228-41187310,41188596-411886...    40   0.002
03_02_0874 + 12017069-12018051,12018137-12018316,12018421-120186...    39   0.003
03_01_0525 + 3952095-3952217,3953131-3953614,3953695-3953750,395...    39   0.003
05_01_0455 - 3614011-3614503,3615007-3615072,3615154-3615347,361...    39   0.003
02_05_1014 + 33510108-33510471,33510857-33511362                       39   0.003
11_08_0081 - 28216179-28216381,28216590-28216657,28217131-282172...    38   0.004
08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526...    38   0.004
07_03_1709 - 28873172-28873327,28873519-28873584,28874067-288741...    38   0.004
07_01_0280 + 2064865-2065080,2065442-2065531,2065690-2065893           38   0.004
05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-28...    38   0.004
04_04_1121 - 31041629-31041793,31041891-31042022,31042255-310424...    38   0.004
11_01_0142 - 1169007-1169032,1169351-1169538,1169978-1170131,117...    38   0.006
01_06_0834 + 32302065-32302143,32303136-32303275,32303371-323034...    38   0.006
03_06_0337 + 33224333-33224479,33224603-33224663,33224740-332247...    38   0.008
07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428...    37   0.010
07_01_0286 + 2086630-2086856,2087052-2087067                           37   0.010
03_03_0042 + 14009649-14009866,14011342-14011419,14011791-140119...    37   0.010
12_02_0849 - 23640091-23640279,23640537-23640677,23640756-236422...    37   0.014
03_06_0507 + 34404843-34404968,34405091-34405151,34405260-344052...    37   0.014
02_05_1015 + 33512023-33512359,33513550-33514082                       36   0.018
04_03_0282 - 13874547-13874738,13875047-13875134,13875222-138753...    36   0.024
12_01_0144 - 1097579-1097604,1097940-1098127,1098567-1098720,109...    36   0.032
11_06_0728 + 26717018-26717306,26717494-26717598,26717789-267178...    36   0.032
11_06_0490 - 24293218-24293373,24293454-24293521,24293845-242939...    36   0.032
01_01_0768 - 5935319-5935417,5935536-5935583,5935721-5935780,593...    36   0.032
12_02_0871 + 23865343-23866016,23866122-23866170,23866276-238663...    35   0.055
02_01_0598 + 4440018-4440070,4440627-4440693,4440794-4440926,444...    35   0.055
08_02_1282 - 25852113-25852406,25852495-25852668,25852849-258529...    34   0.073
06_03_0374 + 20026179-20026661,20027170-20027280,20027372-200274...    34   0.073
04_01_0107 - 1107976-1108033,1108411-1108638,1110109-1110422,111...    34   0.097
12_01_0001 + 1777-1935,2002-2109,2492-2560,2652-2836,3040-3055         33   0.13 
11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377...    33   0.13 
05_04_0383 - 20801036-20801309,20801413-20801538,20801706-208017...    33   0.13 
10_01_0076 - 987092-987671,987747-987812,988201-988363,988467-98...    33   0.17 
07_03_1265 + 25304408-25304545,25304895-25305032,25305746-253058...    33   0.17 
04_03_0630 - 18182681-18182931,18183397-18183463,18184899-181849...    33   0.17 
01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668,298...    33   0.17 
10_02_0023 + 4306350-4306908,4308429-4308814,4308917-4308991,430...    32   0.39 
02_04_0589 - 24117688-24119282,24119881-24119908,24120004-241200...    31   0.52 
01_07_0248 + 42261373-42261609,42261733-42261905,42261986-422620...    31   0.52 
07_03_1779 - 29458889-29459249,29461107-29461283,29461374-294615...    31   0.68 
07_01_0284 - 2082249-2082256,2082496-2083009                           31   0.68 
09_04_0716 + 19702100-19702250,19702366-19702463,19702527-197026...    31   0.90 
04_03_0768 - 19396146-19396607,19397855-19398175,19398424-193995...    31   0.90 
02_05_0544 + 29876337-29876524,29876850-29876882,29878390-298785...    31   0.90 
05_04_0028 + 17302359-17302445,17303887-17303952,17305415-173054...    30   1.2  
03_02_0967 + 12786219-12786305,12786716-12786781,12786897-127869...    30   1.2  
03_02_0875 + 12038365-12039329,12039417-12039593,12039651-120398...    30   1.2  
01_06_1775 - 39808794-39808919,39809021-39809127,39810594-39812178     30   1.2  
03_05_0066 - 20455976-20456161,20456251-20456347,20456608-204567...    30   1.6  
01_06_1531 + 38024757-38024790,38025592-38025803,38026111-380262...    30   1.6  
10_08_0922 - 21593030-21593225,21593319-21594142                       29   2.1  
02_01_0174 - 1193696-1193726,1193822-1194175,1194307-1194542,119...    29   2.1  
04_03_0283 + 13887388-13887573,13887711-13887806,13888517-138886...    29   2.7  
02_01_0500 - 3623837-3624019,3624591-3624778,3625209-3626147,362...    29   2.7  
01_07_0385 - 43212580-43213142,43213234-43213612                       29   2.7  
09_06_0309 - 22206812-22206884,22207008-22207103,22207531-222076...    29   3.6  
07_03_1586 - 27929947-27930056,27930143-27930286,27930377-279307...    29   3.6  
02_02_0658 + 12720873-12720906,12721201-12721664,12723069-127232...    29   3.6  
11_01_0293 + 2207782-2208148,2208515-2208567,2208622-2208698,220...    28   4.8  
07_03_1347 + 25932185-25932748,25933151-25933755,25935797-259362...    28   4.8  
05_04_0375 + 20750170-20751011,20751707-20751865,20752894-207531...    28   4.8  
04_04_0176 - 23329589-23331043                                         28   4.8  
12_01_0754 - 6816789-6816886,6816922-6817722,6818377-6819058           28   6.3  
03_02_0842 + 11682332-11683802,11683858-11683940,11684751-116865...    28   6.3  
02_05_0807 + 31870018-31870953                                         28   6.3  
10_01_0168 - 1883380-1883594,1884572-1888325                           27   8.4  
07_01_1143 - 10711023-10711884,10713603-10713826,10714253-107145...    27   8.4  
06_01_1037 - 8140602-8140782,8141489-8141545,8141649-8141845,814...    27   8.4  

>02_02_0100 -
           6783821-6784339,6784815-6784984,6785062-6785164,
           6785291-6785454,6786781-6786821,6786933-6787129
          Length = 397

 Score =  120 bits (289), Expect = 9e-28
 Identities = 53/114 (46%), Positives = 80/114 (70%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D  GK+FVGG++WET++E+  ++F +YG + D V+MK+  +   RGFGFVTF+DPS+++ 
Sbjct: 63  DSSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDK 122

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VL++  H +DGRT++ K   PR     K G    K+F+GGLPS++TE +LR  F
Sbjct: 123 VLED-EHVIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPSSLTEDELREHF 175



 Score = 66.5 bits (155), Expect = 1e-11
 Identities = 31/85 (36%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D  +  K+FVGGL    +++ L+ +FS YG++++  +M +  +GRSRGFGFVTF     V
Sbjct: 150 DGPKTRKIFVGGLPSSLTEDELREHFSPYGKIVEHQIMLDHSTGRSRGFGFVTFESEDSV 209

Query: 251 NLVLQNG-PHQLDGRTIDPKPCNPR 322
             V+  G    L G+ ++ K   P+
Sbjct: 210 ERVISEGRMRDLGGKQVEIKKAEPK 234



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F  YGK++E  IM D    +S G GF++FE E S
Sbjct: 175 FSPYGKIVEHQIMLDHSTGRSRGFGFVTFESEDS 208



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + + VIM D+  K   G GF++F D
Sbjct: 86  FEKYGAITDSVIMKDKHTKMPRGFGFVTFSD 116


>06_03_0500 +
           21470681-21470952,21471049-21471089,21472322-21472485,
           21472577-21472679,21472806-21472975,21473766-21474239
          Length = 407

 Score =  116 bits (278), Expect = 2e-26
 Identities = 51/114 (44%), Positives = 78/114 (68%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D  GK+FVGG++WET++E+  ++F +YG + D V+MK+  +   RGFGFVTF+DPS+++ 
Sbjct: 88  DSSGKIFVGGVAWETTEESFTKHFEKYGAISDSVIMKDKHTKMPRGFGFVTFSDPSVIDK 147

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VLQ+  H +DGRT++ K   PR     K G    K+F+GG+P ++TE  L+  F
Sbjct: 148 VLQD-EHTIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGIPPSLTEDKLKEHF 200



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 36/95 (37%), Positives = 56/95 (58%), Gaps = 1/95 (1%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D  +  K+FVGG+    +++ L+ +FS YG+V++  +M +  +GRSRGFGFVTF +   V
Sbjct: 175 DGPKTRKIFVGGIPPSLTEDKLKEHFSSYGKVVEHQIMLDHGTGRSRGFGFVTFENEDAV 234

Query: 251 NLVLQNG-PHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             V+  G  H L G+ ++ K   P+     K GGG
Sbjct: 235 ERVMSEGRMHDLAGKQVEIKKAEPK-----KPGGG 264



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  YGKV+E  IM D    +S G GF++FE+E
Sbjct: 200 FSSYGKVVEHQIMLDHGTGRSRGFGFVTFENE 231



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + + VIM D+  K   G GF++F D
Sbjct: 111 FEKYGAISDSVIMKDKHTKMPRGFGFVTFSD 141


>10_08_0338 + 16916429-16916650,16916728-16917900
          Length = 464

 Score = 95.9 bits (228), Expect(2) = 1e-24
 Identities = 43/87 (49%), Positives = 62/87 (71%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           + ++GKLF+GG+SWET++E L+ +F+ YG+V    VM++  +GR RGFGFV F+DPS V+
Sbjct: 2   ESDQGKLFIGGISWETTEEKLRDHFAAYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVD 61

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQK 334
             L + PH LDGRT+D K    R  Q+
Sbjct: 62  AALVD-PHTLDGRTVDVKRALSREEQQ 87



 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 34/88 (38%), Positives = 47/88 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    +++  ++YF  YG V D VVM +  + R RGFGF+TF     V+ VL  
Sbjct: 129 KIFVGGLPSNLTEDEFRQYFQTYGVVTDVVVMYDQNTQRPRGFGFITFDAEDAVDRVLHK 188

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H L G+ ++ K   PR        GG
Sbjct: 189 TFHDLSGKMVEVKRALPREANPGSGSGG 216



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F  YG V +VV+MYDQ  ++  G GF++F+ E +  +   +T H
Sbjct: 147 YFQTYGVVTDVVVMYDQNTQRPRGFGFITFDAEDAVDRVLHKTFH 191



 Score = 34.7 bits (76), Expect(2) = 1e-24
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +2

Query: 344 GGGYPKVFLGGLPSNVTETDLRXIFRT 424
           G    K+F+GGLPSN+TE + R  F+T
Sbjct: 124 GARTKKIFVGGLPSNLTEDEFRQYFQT 150



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 2/45 (4%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QS--DPRTL 545
           F  YG V +  +M D+   +  G GF+ F D  S   +  DP TL
Sbjct: 26  FAAYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVDAALVDPHTL 70


>07_03_1061 + 23651404-23651625,23651764-23652954
          Length = 470

 Score =  107 bits (258), Expect = 5e-24
 Identities = 56/124 (45%), Positives = 76/124 (61%), Gaps = 11/124 (8%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GKLFVGG+SWET ++ L+ YFSR+GEV + V+M++  +GR+RGFGFV F D  +   V
Sbjct: 4   DSGKLFVGGISWETDEDRLREYFSRFGEVTEAVIMRDRNTGRARGFGFVVFTDAGVAERV 63

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQK--PKRGG---GYP------KVFLGGLPSNVTETDL 406
             +  H +DGR ++ K   PR  Q    K  G   G P      K+F+GGL SNVTE + 
Sbjct: 64  TMD-KHMIDGRMVEAKKAVPRDDQSITSKNNGSSIGSPGPGRTRKIFVGGLASNVTEVEF 122

Query: 407 RXIF 418
           R  F
Sbjct: 123 RRYF 126



 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 28/78 (35%), Positives = 47/78 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+   ++   +RYF ++G + D VVM +  + R RGFGF+T+     V+  L  
Sbjct: 107 KIFVGGLASNVTEVEFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHK 166

Query: 269 GPHQLDGRTIDPKPCNPR 322
             H+L+G+ ++ K   P+
Sbjct: 167 NFHELNGKMVEVKRAVPK 184



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 12/45 (26%), Positives = 28/45 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G + +VV+MYD   ++  G GF++++ E +  ++  +  H
Sbjct: 125 YFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHKNFH 169



 Score = 34.3 bits (75), Expect = 0.073
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F R+G+V E VIM D+   ++ G GF+ F D
Sbjct: 25  YFSRFGEVTEAVIMRDRNTGRARGFGFVVFTD 56


>11_06_0497 + 24337772-24337993,24338042-24338083,24338176-24339357
          Length = 481

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 58/138 (42%), Positives = 81/138 (58%), Gaps = 25/138 (18%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GKLF+GG+SW+T+++ L+ YF +YGEV++ V+M++  +GR+RGFGF+ FADP++   V
Sbjct: 4   DAGKLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDRATGRARGFGFIVFADPAVAERV 63

Query: 260 LQNGPHQLDGRTI--------DP------KPCNPRTLQK--PKRGG---GYP------KV 364
           +    H +DGR I        DP      K   PR  Q    K GG   G P      K+
Sbjct: 64  IME-KHMIDGRMIHDDDDGVLDPSMVVEAKKAVPRDDQHALSKSGGSAHGSPGPSRTKKI 122

Query: 365 FLGGLPSNVTETDLRXIF 418
           F+GGL S VTE D R  F
Sbjct: 123 FVGGLASTVTEADFRKYF 140



 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 28/80 (35%), Positives = 49/80 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+   ++ + ++YF ++G + D VVM +  + R RGFGF+T+     V+  L  
Sbjct: 121 KIFVGGLASTVTEADFRKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALFK 180

Query: 269 GPHQLDGRTIDPKPCNPRTL 328
             H+L+G+ ++ K   P+ L
Sbjct: 181 TFHELNGKMVEVKRAVPKEL 200



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 354 TLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSD 533
           T +  + G   T+ +     +F ++G + +VV+MYD   ++  G GF++++ E +  ++ 
Sbjct: 119 TKKIFVGGLASTVTEADFRKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKAL 178

Query: 534 PRTLH 548
            +T H
Sbjct: 179 FKTFH 183



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YG+V+E VIM D+   ++ G GF+ F D
Sbjct: 25  YFDKYGEVVEAVIMRDRATGRARGFGFIVFAD 56


>07_01_0628 - 4691991-4692806,4694291-4694293,4694527-4694637
          Length = 309

 Score = 87.8 bits (208), Expect = 6e-18
 Identities = 43/88 (48%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDC-VVMKNSESGRSRGFGFVTFADPS 244
           M + E G++FVGGLSW+T++  L+R FS YG+VI+  +V+   ++GRSRGFGFVTF++P 
Sbjct: 1   MAEKEVGRIFVGGLSWDTTERTLERAFSEYGKVIETQMVVLERDTGRSRGFGFVTFSEPR 60

Query: 245 LVNLVLQNGPH--QLDGRTIDPKPCNPR 322
            V+  ++ G H  +LDGRTI      PR
Sbjct: 61  AVDAAIR-GMHNGELDGRTISVNKAQPR 87


>01_07_0160 -
           41563109-41563468,41563566-41563985,41564082-41564263,
           41564362-41564542,41565066-41565084,41565185-41565445,
           41566140-41566253,41566264-41566331,41566890-41567018,
           41567141-41567245,41567317-41567456,41567519-41567687,
           41567824-41567900,41568133-41568187,41568660-41568705,
           41568806-41568894,41568996-41569061,41569360-41569425,
           41569817-41569906,41570009-41570026
          Length = 884

 Score = 81.0 bits (191), Expect = 6e-16
 Identities = 42/115 (36%), Positives = 61/115 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL V G+ W+   E L+ Y  ++G + DCVVMK   SGRSRGFG+VTF+       VL+ 
Sbjct: 4   KLVVLGIPWDVDTEGLREYMGKFGPLDDCVVMKERSSGRSRGFGYVTFSSADDAKNVLE- 62

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
             H L  RT++ K   P+   K +      ++F+  +P +V E+  R  F    E
Sbjct: 63  CEHVLGNRTLEVKIATPKEEMKSQGSKKATRIFVARIPQSVDESMFRRHFEAYGE 117



 Score = 60.9 bits (141), Expect = 7e-10
 Identities = 31/89 (34%), Positives = 49/89 (55%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L  E + E+L+ YF ++G ++D  + K+ +    RGFGFVTFAD  + + V + 
Sbjct: 240 KIFVGRLPQEANTEDLRHYFGKFGRIVDAYIPKDPKRSGHRGFGFVTFADEGVADRVARR 299

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
             H++ G  +      P    +   GGGY
Sbjct: 300 S-HEILGHEVAIDTAAP---LEGDSGGGY 324



 Score = 53.2 bits (122), Expect = 1e-07
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 6/95 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++FV  +     +   +R+F  YGE+ D  + K   S   RG GF+TF     V+ ++Q+
Sbjct: 93  RIFVARIPQSVDESMFRRHFEAYGEITDLYMPKEHGSKGHRGIGFITFQSAESVDSIMQD 152

Query: 269 GPHQLDGRTIDPKPCNPRTLQ---KPKRG---GGY 355
             H+LDG T+      P+  +    P RG   GGY
Sbjct: 153 S-HELDGTTVVVDRATPKDEEVRYPPSRGASQGGY 186



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 11/33 (33%), Positives = 21/33 (63%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +FG++G++++  I  D  +    G GF++F DE
Sbjct: 258 YFGKFGRIVDAYIPKDPKRSGHRGFGFVTFADE 290


>08_02_0181 +
           13923658-13923661,13925518-13925681,13925879-13925978,
           13926072-13926244,13926486-13927016
          Length = 323

 Score = 78.6 bits (185), Expect = 3e-15
 Identities = 35/94 (37%), Positives = 62/94 (65%)
 Frame = +2

Query: 137 QRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCN 316
           + YF +YGE++D V+MK+  + + RGFGF+TFADP++V+ V+++  H ++G+ ++ K   
Sbjct: 5   KEYFGKYGEIVDAVIMKDRFTQKPRGFGFITFADPAVVDRVIEDN-HVINGKEVEIKRTI 63

Query: 317 PRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           P+    P +     K+F+GGLPS + E + +  F
Sbjct: 64  PKG-AAPLKDFKTKKIFVGGLPSALKEDEFKEFF 96



 Score = 58.0 bits (134), Expect = 5e-09
 Identities = 28/92 (30%), Positives = 54/92 (58%), Gaps = 2/92 (2%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPS 244
           + D +  K+FVGGL     ++  + +FS++G+V++  ++++  + RSRGFGFV F A+ +
Sbjct: 70  LKDFKTKKIFVGGLPSALKEDEFKEFFSKFGKVVEHEIIRDHSTNRSRGFGFVVFDAEKT 129

Query: 245 LVNLVLQNGPH-QLDGRTIDPKPCNPRTLQKP 337
           +  L+ + G    L+G  ++ K   P+    P
Sbjct: 130 VDELLAKKGNMIDLNGSQVEIKKAEPKKPSNP 161



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 14/32 (43%), Positives = 24/32 (75%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +FG+YG++++ VIM D+  +K  G GF++F D
Sbjct: 7   YFGKYGEIVDAVIMKDRFTQKPRGFGFITFAD 38



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF ++GKV+E  I+ D    +S G GF+ F+ E
Sbjct: 95  FFSKFGKVVEHEIIRDHSTNRSRGFGFVVFDAE 127


>06_03_0794 -
           24671955-24672362,24672469-24672505,24672804-24672858,
           24674044-24674167,24674670-24674903
          Length = 285

 Score = 77.4 bits (182), Expect = 8e-15
 Identities = 35/83 (42%), Positives = 52/83 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  E L+ +F  YGE+++ VV+ +  +GRS+G+GFVTF DP    +   +
Sbjct: 34  KVFVGGLAWETRSEGLRAHFEAYGEILEAVVITDRATGRSKGYGFVTFRDPDSARMACMD 93

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP 337
               +DGR  +   CN   L +P
Sbjct: 94  PYPVIDGRRAN---CNLAILGRP 113



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 13/34 (38%), Positives = 22/34 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F  YG+++E V++ D+   +S G GF++F D  S
Sbjct: 53  FEAYGEILEAVVITDRATGRSKGYGFVTFRDPDS 86


>03_02_0346 - 7666500-7666646,7666744-7666902
          Length = 101

 Score = 76.6 bits (180), Expect = 1e-14
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query: 68  MDDDEK-GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           MD D    KLFVGGL WET  + ++R+F ++GE+++ VV+ +  +GRS+G+GFVTF DP 
Sbjct: 1   MDGDTTFTKLFVGGLPWETRGDAVRRHFEQFGEIVEAVVIADKHTGRSKGYGFVTFRDPD 60

Query: 245 LVNLVLQNGPHQLDGR 292
                LQ+    +DGR
Sbjct: 61  GAARALQDPTPVIDGR 76



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 11/31 (35%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F ++G+++E V++ D+   +S G GF++F D
Sbjct: 28  FEQFGEIVEAVVIADKHTGRSKGYGFVTFRD 58


>01_06_1533 +
           38041499-38041681,38041853-38041985,38042816-38042954,
           38043331-38043367,38045606-38045897,38046384-38046502
          Length = 300

 Score = 76.6 bits (180), Expect = 1e-14
 Identities = 30/68 (44%), Positives = 48/68 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET +E +++YF ++GE+++ VV+ +  +GRS+G+GFVTF DP        +
Sbjct: 17  KVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPDAAMRACVD 76

Query: 269 GPHQLDGR 292
               +DGR
Sbjct: 77  PAPVIDGR 84



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 11/32 (34%), Positives = 23/32 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F ++G+++E V++ D+   +S G GF++F D
Sbjct: 35  YFEQFGEILEAVVITDKNTGRSKGYGFVTFRD 66


>12_02_0450 +
           19172812-19172920,19173020-19173088,19173168-19173274,
           19173874-19174365
          Length = 258

 Score = 75.4 bits (177), Expect = 3e-14
 Identities = 40/97 (41%), Positives = 56/97 (57%), Gaps = 1/97 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGLS+ T +++L+  F+ YG+VI+  ++ + E+GRSRGFGF+T+A     +  +  
Sbjct: 32  KLFVGGLSYGTDEQSLRDTFANYGQVIEAKIINDRETGRSRGFGFITYASSEEASAAITA 91

Query: 269 -GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
                LDGR I     N RT      GGGY     GG
Sbjct: 92  LDGKDLDGRNIRVNTANERTGGFRSGGGGYGGGGYGG 128



 Score = 29.1 bits (62), Expect = 2.7
 Identities = 11/29 (37%), Positives = 19/29 (65%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F  YG+V+E  I+ D+   +S G GF+++
Sbjct: 51  FANYGQVIEAKIINDRETGRSRGFGFITY 79


>06_01_0824 -
           6219477-6219556,6220427-6220808,6221415-6221448,
           6222214-6222370,6224449-6224575,6224663-6224914
          Length = 343

 Score = 74.9 bits (176), Expect = 4e-14
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  E L+R+F +YGE+++ VV+ +  +GRS+G+GFVTF +       +Q+
Sbjct: 40  KVFVGGLAWETPSEGLRRHFEQYGEILEAVVIADRLTGRSKGYGFVTFREAEAARRAVQD 99

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPK 340
               + GR  +   CN  +L  P+
Sbjct: 100 PNPMIAGRRAN---CNIASLGPPR 120



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 11/31 (35%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG+++E V++ D+   +S G GF++F +
Sbjct: 59  FEQYGEILEAVVIADRLTGRSKGYGFVTFRE 89


>02_05_0796 +
           31800256-31800528,31800635-31800758,31802642-31802771,
           31804336-31804414,31804848-31805133,31805273-31805385
          Length = 334

 Score = 74.9 bits (176), Expect = 4e-14
 Identities = 33/84 (39%), Positives = 54/84 (64%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  + LQ +F +YGE+++ VV+ + E+ RS+G+GFVTF +P      ++N
Sbjct: 47  KVFVGGLAWETPSKGLQDHFQQYGEILEAVVITDRETSRSKGYGFVTFREPESAREAVRN 106

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPK 340
               + GR  +   CN  ++  P+
Sbjct: 107 PNPTIGGRRAN---CNIASMGPPR 127



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG+++E V++ D+   +S G GF++F +  S
Sbjct: 66  FQQYGEILEAVVITDRETSRSKGYGFVTFREPES 99


>08_02_1101 -
           24308433-24308978,24309195-24309364,24309443-24309542,
           24310337-24310500,24310960-24310996,24311222-24311262,
           24313877-24314093
          Length = 424

 Score = 74.5 bits (175), Expect = 6e-14
 Identities = 32/102 (31%), Positives = 65/102 (63%)
 Frame = +2

Query: 116 ETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRT 295
           E  + +  ++F +YGE++D V+M++  + + RGFGF+T+++P++V+ V+ +  H+ +G+ 
Sbjct: 95  EPDEADFVKHFGQYGEIVDSVIMRDKHTSQPRGFGFITYSNPAVVDRVMDD-IHEFNGKQ 153

Query: 296 IDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
           ++ K   P+   + K      K+F+GGLP  +TE D +  F+
Sbjct: 154 VEIKRTIPKDSVQSK-DFKTKKIFVGGLPQALTEDDFKHFFQ 194



 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 30/89 (33%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVGGL    ++++ + +F +YG V+D  +M++ ++ RSRGFGF+ F+   +V+
Sbjct: 169 DFKTKKIFVGGLPQALTEDDFKHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVD 228

Query: 254 LVLQNGPH-QLDGRTIDPKPCNPRTLQKP 337
            +L NG    L G  ++ K   P+    P
Sbjct: 229 DLLANGNMIDLAGAKVEIKKAEPKKSSNP 257



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +3

Query: 354 TLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           T +  + G  + L +     FF +YG V++  IM D   K+S G GF+ F  +
Sbjct: 172 TKKIFVGGLPQALTEDDFKHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSD 224



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 11/31 (35%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           FG+YG++++ VIM D+   +  G GF+++ +
Sbjct: 105 FGQYGEIVDSVIMRDKHTSQPRGFGFITYSN 135


>03_05_0630 + 26260159-26260272,26260520-26260894
          Length = 162

 Score = 74.1 bits (174), Expect = 7e-14
 Identities = 38/94 (40%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVN 253
           D + + FVGGL+W T   +L+  FS YGE++D  ++ + E+GRSRGFGFVTF ++ S+ +
Sbjct: 5   DVEYRCFVGGLAWATDDRSLEAAFSTYGEILDSKIINDRETGRSRGFGFVTFSSEQSMRD 64

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
            +      +LDGR I       R  +    GGGY
Sbjct: 65  AIEGMNGKELDGRNITVNEAQSR--RSGGGGGGY 96



 Score = 30.7 bits (66), Expect = 0.90
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F  YG++++  I+ D+   +S G GF++F  E S
Sbjct: 28  FSTYGEILDSKIINDRETGRSRGFGFVTFSSEQS 61


>01_06_1799 +
           39948481-39948607,39948694-39948762,39948859-39948965,
           39949257-39949406
          Length = 150

 Score = 71.7 bits (168), Expect = 4e-13
 Identities = 40/91 (43%), Positives = 58/91 (63%), Gaps = 2/91 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVL 262
           KLFVGGLSW T+ ++L+  F+ +G+V +  V+ + ESGRSRGFGFV+FA  D +   +  
Sbjct: 38  KLFVGGLSWNTNDDSLKEAFTSFGDVTEARVINDRESGRSRGFGFVSFANGDDAKSAMDA 97

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
            +G  +L+GR+I     N R     + GGGY
Sbjct: 98  MDG-KELEGRSIRVNFANERP-PGNRGGGGY 126


>01_07_0243 + 42240553-42240750,42241114-42241255,42242327-42242442
          Length = 151

 Score = 70.9 bits (166), Expect = 7e-13
 Identities = 28/68 (41%), Positives = 47/68 (69%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET +E ++ YF ++G++++ VV+ +  +GRS+G+GFVTF +P        +
Sbjct: 22  KVFVGGLAWETQKEGMRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPEAAMKACFD 81

Query: 269 GPHQLDGR 292
               +DGR
Sbjct: 82  PYPVIDGR 89


>01_06_0833 + 32296957-32297256,32299257-32299895
          Length = 312

 Score = 70.9 bits (166), Expect = 7e-13
 Identities = 43/121 (35%), Positives = 64/121 (52%), Gaps = 5/121 (4%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           GK+FVGG+   TS+  L+ +FSR+G V      KN ++G +RGF FV F +P      + 
Sbjct: 29  GKVFVGGVPLGTSESELRAHFSRFGTVAFVGAPKNKQTGAARGFAFVQFVNPDDAAAAIA 88

Query: 266 NGPHQ--LDGRTIDPKPCNPR-TLQKPKRGGG--YPKVFLGGLPSNVTETDLRXIFRTLW 430
            GP +  + G T+D K    + +   P+   G    K+F+GGLP + TE  L+  F    
Sbjct: 89  AGPDRNVIRGTTMDIKLAQLKPSAGGPQLSPGDQKRKIFVGGLPVSATEKKLKEYFNKFG 148

Query: 431 E 433
           E
Sbjct: 149 E 149



 Score = 58.0 bits (134), Expect = 5e-09
 Identities = 27/82 (32%), Positives = 46/82 (56%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+K K+FVGGL    +++ L+ YF+++GEV   +V+ +  +   RGFGF+ FA       
Sbjct: 121 DQKRKIFVGGLPVSATEKKLKEYFNKFGEVNRAIVVIDLNTKMPRGFGFIQFASEESTAR 180

Query: 257 VLQNGPHQLDGRTIDPKPCNPR 322
            L+   H L G+ ++     P+
Sbjct: 181 ALKKDKHFLCGQWVEVSLAMPK 202


>12_02_1219 + 27096477-27096590,27096704-27097078
          Length = 162

 Score = 70.5 bits (165), Expect = 9e-13
 Identities = 39/102 (38%), Positives = 58/102 (56%), Gaps = 2/102 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D + + FVGGL+W T   +L+  FS +GE+++  ++ + E+GRSRGFGFVTF+    +  
Sbjct: 5   DVEYRCFVGGLAWATDDRSLEAAFSTFGEILESKIINDRETGRSRGFGFVTFSSEQAMRD 64

Query: 257 VLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
            ++  NG  +LDGR I       R       GGGY +   GG
Sbjct: 65  AIEGMNG-KELDGRNITVNEAQSRR-SGGGGGGGYGQRGGGG 104


>07_01_0182 + 1280479-1280754,1281232-1282089
          Length = 377

 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 35/96 (36%), Positives = 51/96 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL    ++E  + YF  +G V D VV+ +S + RSRGFGFVTF     V  V+++
Sbjct: 145 KVFIGGLRDNITEEEFKTYFESFGTVTDVVVIYDSMTNRSRGFGFVTFDSEEAVRKVIEH 204

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H L G  ++ K   P+     + G G      GG
Sbjct: 205 SFHDLKGTRVEAKIAIPKDASYYRNGRGRGSRNFGG 240



 Score = 60.9 bits (141), Expect = 7e-10
 Identities = 31/84 (36%), Positives = 45/84 (53%), Gaps = 3/84 (3%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ KLFVGG+     +  L+ +F +YG V   +VM++ E+G  RGFGFV F +       
Sbjct: 18  ERRKLFVGGIPTSAQEAELRGHFGQYGAVRSVIVMRDKETGHGRGFGFVEFEEEEDAARA 77

Query: 260 LQNGPHQ---LDGRTIDPKPCNPR 322
           L +G H    + GR +D K    R
Sbjct: 78  LGDGEHPRHLICGRVVDVKRARAR 101



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F  +G V +VV++YD    +S G GF++F+ E
Sbjct: 163 YFESFGTVTDVVVIYDSMTNRSRGFGFVTFDSE 195



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FG+YG V  V++M D+      G GF+ FE+E
Sbjct: 40  FGQYGAVRSVIVMRDKETGHGRGFGFVEFEEE 71



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIFRT 424
           KVF+GGL  N+TE + +  F +
Sbjct: 145 KVFIGGLRDNITEEEFKTYFES 166


>03_06_0105 + 31675083-31675313,31676171-31676815
          Length = 291

 Score = 67.7 bits (158), Expect = 6e-12
 Identities = 31/79 (39%), Positives = 49/79 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    + ++L  YF ++G + D VVM+N  + R+RGFGF++F     V  +L N
Sbjct: 113 KVFVGGLHETVTVKDLISYFEKFGTITDAVVMRNRTTNRARGFGFISFDSHEAVCKILLN 172

Query: 269 GPHQLDGRTIDPKPCNPRT 325
             H L+GR ++ K   P++
Sbjct: 173 RFHNLNGRDVEVKIAVPKS 191



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 48/130 (36%), Positives = 62/130 (47%), Gaps = 17/130 (13%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ KLFV GL  +T + +L+ +F+RYGEV+   V+ +  SG SRGFGFV FAD +     
Sbjct: 3   EERKLFVAGLPQQTREGDLRGHFARYGEVVHTRVVLDMASGNSRGFGFVEFADEAATLRA 62

Query: 260 LQNGP---HQLDGRTIDPKPCNPR-----TLQKPKRGGG---------YPKVFLGGLPSN 388
           L +     H   GR +D K    R     T    K               KVF+GGL   
Sbjct: 63  LADDEMPNHVFRGRKVDVKRAERRHDHKQTSPSIKNQNDSVQKNQFIFQKKVFVGGLHET 122

Query: 389 VTETDLRXIF 418
           VT  DL   F
Sbjct: 123 VTVKDLISYF 132



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F RYG+V+   ++ D     S G GF+ F DE
Sbjct: 25  FARYGEVVHTRVVLDMASGNSRGFGFVEFADE 56



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 12/46 (26%), Positives = 26/46 (56%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           + G H T+       +F ++G + + V+M ++   ++ G GF+SF+
Sbjct: 116 VGGLHETVTVKDLISYFEKFGTITDAVVMRNRTTNRARGFGFISFD 161


>01_05_0696 - 24366857-24368200
          Length = 447

 Score = 67.7 bits (158), Expect = 6e-12
 Identities = 45/150 (30%), Positives = 71/150 (47%), Gaps = 11/150 (7%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFV GL WET+ ++L+  FS +G++ + VV+ +  +GRS+G+GFVTF       L L+ 
Sbjct: 77  KLFVRGLGWETNSDSLRAIFSAFGDLEEAVVITDKSTGRSKGYGFVTFRHADSAVLALKE 136

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRG----GGYP-------KVFLGGLPSNVTETDLRXI 415
              ++DGR    +            G    GG P       K+F+G +P+++    L   
Sbjct: 137 PSKKIDGRMTVTQLAAAGAAGGASGGAAGAGGAPAADVSLRKIFVGNVPADMPSERLLAH 196

Query: 416 FRTLWEGHGGGHYV*SXEEKVXGFXILVFR 505
           F    E   G         K  GF + V++
Sbjct: 197 FAAYGEIEEGPLGFDKQTGKFRGFALFVYK 226



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 9/107 (8%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-----SLVN 253
           K+FVG +  +   E L  +F+ YGE+ +  +  + ++G+ RGF    +  P     SLV+
Sbjct: 178 KIFVGNVPADMPSERLLAHFAAYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQASLVD 237

Query: 254 LVLQNGPHQLDGR-TIDPKPCNPRTLQKPKRGGG---YPKVFLGGLP 382
            V     HQL  +  I+ K       Q+ + G G    P++  GG P
Sbjct: 238 SVKVIDGHQLVCKLAIEGKKGKQSQQQQQQSGPGGAQPPQMLQGGPP 284


>07_03_1378 +
           26158233-26158562,26159075-26159176,26159551-26159850,
           26160006-26160068
          Length = 264

 Score = 67.3 bits (157), Expect = 8e-12
 Identities = 34/75 (45%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D   KL+VG L+W      L+  FS  G V+D  V+ + ESGRSRGFGFVT+     VN 
Sbjct: 177 DSSNKLYVGNLAWGVDNSTLENLFSEQGTVLDAKVIYDRESGRSRGFGFVTYGSAEEVNN 236

Query: 257 VLQN-GPHQLDGRTI 298
            + N     LDGR I
Sbjct: 237 AISNLDGVDLDGRQI 251



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 38/121 (31%), Positives = 57/121 (47%), Gaps = 11/121 (9%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           K+FVG L +      L   F + G V    V+ + ++GRSRGFGFVT +        ++ 
Sbjct: 81  KVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRQTGRSRGFGFVTMSTAEEAGAAVEQ 140

Query: 266 -NGPHQLDGR--TIDPKPCNPRTLQKPK--RGGG-----YPKVFLGGLPSNVTETDLRXI 415
            NG +   GR   ++  P  PR    P+  RGGG       K+++G L   V  + L  +
Sbjct: 141 FNG-YTFQGRPLRVNSGPPPPRDDFAPRSPRGGGSNFDSSNKLYVGNLAWGVDNSTLENL 199

Query: 416 F 418
           F
Sbjct: 200 F 200



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F   G V++  ++YD+   +S G GF+++
Sbjct: 200 FSEQGTVLDAKVIYDRESGRSRGFGFVTY 228


>02_05_0506 +
           29613307-29613601,29613641-29613678,29613679-29613802,
           29614358-29614484,29614915-29615002,29615539-29615631,
           29616380-29616529
          Length = 304

 Score = 67.3 bits (157), Expect = 8e-12
 Identities = 25/47 (53%), Positives = 40/47 (85%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           K+FVGGL+WET+ E L+R++ R+GE+++ VV+ +  SGRS+G+GFV+
Sbjct: 38  KVFVGGLAWETTSERLRRFYDRFGEILEAVVITDRHSGRSKGYGFVS 84



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           F+ R+G+++E V++ D+   +S G GF+S
Sbjct: 56  FYDRFGEILEAVVITDRHSGRSKGYGFVS 84


>03_06_0587 - 34921535-34922041,34922579-34922689
          Length = 205

 Score = 65.3 bits (152), Expect = 3e-11
 Identities = 35/95 (36%), Positives = 54/95 (56%), Gaps = 2/95 (2%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M D E+ + F+G LSW T+ E+L+  F ++G + +  V+ +  SGRSRGFGFVTF +   
Sbjct: 1   MADVEEYRCFIGNLSWSTTDESLKDAFGKFGNLTEAKVVFDKYSGRSRGFGFVTFDEKKA 60

Query: 248 VNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRG 346
           +   ++  NG   LDGR I      P+   + + G
Sbjct: 61  MEDAIEGMNG-LDLDGRAITVDKAQPQGPGRDRNG 94



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 13/55 (23%), Positives = 29/55 (52%)
 Frame = +3

Query: 348 VDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           V+  RC +     +         FG++G + E  +++D+   +S G GF++F+++
Sbjct: 4   VEEYRCFIGNLSWSTTDESLKDAFGKFGNLTEAKVVFDKYSGRSRGFGFVTFDEK 58


>03_02_0613 -
           9848514-9848539,9848942-9849200,9849326-9849365,
           9849952-9850117,9850228-9850756
          Length = 339

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 22/51 (43%), Positives = 40/51 (78%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           K+FVGGL+WET ++ L+ +F R+G++++ V++ +  +GRS+G+GFV+   P
Sbjct: 34  KVFVGGLAWETHKDTLREHFERFGDILEAVIISDKLTGRSKGYGFVSSTTP 84



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           F R+G ++E VI+ D+   +S G GF+S
Sbjct: 53  FERFGDILEAVIISDKLTGRSKGYGFVS 80


>08_02_1559 -
           27873345-27873407,27873549-27873830,27874162-27874263,
           27874402-27874872
          Length = 305

 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           + +VG L W+     L + FS +GEV++  V+ + ESGRSRGFGFV+ A        L +
Sbjct: 222 RAYVGNLPWQVDDSRLLQLFSEHGEVVNASVVYDRESGRSRGFGFVSMASKE----ELDD 277

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRG 346
               LDG+ +D +P       ++P+RG
Sbjct: 278 AISALDGQELDGRPLRVNVAAERPQRG 304



 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 34/117 (29%), Positives = 62/117 (52%), Gaps = 4/117 (3%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K++VG L ++   E L + F + G V    V+ N E+G+SRGFGFVT +     +  
Sbjct: 125 EEAKVYVGNLPYDVDSEGLAQLFEQAGVVEVAEVIYNRETGQSRGFGFVTMSTIEEADKA 184

Query: 260 LQN-GPHQLDGRTIDPKPCNPR--TLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIF 418
           ++    + ++GR ++     PR   +++P R      + ++G LP  V ++ L  +F
Sbjct: 185 IEMLNRYDINGRLLNVNRAAPRGSRVERPPRQFAPAFRAYVGNLPWQVDDSRLLQLF 241



 Score = 28.3 bits (60), Expect = 4.8
 Identities = 10/28 (35%), Positives = 18/28 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           F  +G+V+   ++YD+   +S G GF+S
Sbjct: 241 FSEHGEVVNASVVYDRESGRSRGFGFVS 268


>04_04_1294 - 32424762-32426309
          Length = 515

 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 30/73 (41%), Positives = 42/73 (57%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D    KLFV GL W    ++L+  FSR+GE+ DC V+ + +SGRS+G+GFV F       
Sbjct: 110 DPASRKLFVHGLGWGAGADDLRSAFSRFGELEDCRVISDKQSGRSKGYGFVLFRSRRSAL 169

Query: 254 LVLQNGPHQLDGR 292
             L+    Q+ GR
Sbjct: 170 RALRRPQLQIGGR 182



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 1/89 (1%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D+ + K+FVG +  +   + L  YFS++GE+ +  +  +  +G+ +GF    +       
Sbjct: 226 DNMQRKIFVGNVHADVDVDRLYEYFSQFGEIEEGPLGFDKTTGKPKGFALFVYKSVESAR 285

Query: 254 LVLQNGPHQLDGRTID-PKPCNPRTLQKP 337
             L+      DG+ ++  K  + RT   P
Sbjct: 286 RALEEPTRNFDGKMLNVQKAIDGRTKNTP 314


>03_05_0702 - 26934736-26935551,26937494-26937538,26938484-26938594
          Length = 323

 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 36/101 (35%), Positives = 53/101 (52%), Gaps = 16/101 (15%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDC---------------VVMKNSESG 202
           M   E+G++FVGGLS+ T +  L   F R+G+V+D                ++M    + 
Sbjct: 1   MAGKEEGRIFVGGLSFHTDERKLADAFRRFGKVVDAQWFGSFCGSFVNQVILIMLERHTQ 60

Query: 203 RSRGFGFVTFADPSLVNLVLQN-GPHQLDGRTIDPKPCNPR 322
           R RGFGFVTF+DP  V+  ++     +LDGRTI      P+
Sbjct: 61  RHRGFGFVTFSDPEAVDSAIKEMHCQELDGRTISVNKAEPK 101


>03_03_0130 -
           14699658-14699723,14699828-14700109,14700444-14700545,
           14701038-14701385
          Length = 265

 Score = 59.3 bits (137), Expect = 2e-09
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV-NL 256
           E  +++VG LSW      L   FS  GEV++  V+ + ESGRSRGFGFVT+     V N 
Sbjct: 178 EANRVYVGNLSWGVDNAALANLFSGEGEVLEAKVIYDRESGRSRGFGFVTYGSAEEVENA 237

Query: 257 VLQNGPHQLDGRTI 298
           V       +DGR I
Sbjct: 238 VSNLDGADMDGRQI 251



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           ++FVG L +      L   F + G V    V+ +  +GRSRGFGFVT +    V   ++ 
Sbjct: 87  RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTMSSVEEVEAAVEQ 146

Query: 266 -NGPHQLDGRTI----DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            NG + LDGR++     P P   ++ Q+  RG    +V++G L   V    L  +F
Sbjct: 147 FNG-YILDGRSLRVNSGPPPPREQSSQRAPRGEA-NRVYVGNLSWGVDNAALANLF 200



 Score = 28.3 bits (60), Expect = 4.8
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F   G+V+E  ++YD+   +S G GF+++
Sbjct: 200 FSGEGEVLEAKVIYDRESGRSRGFGFVTY 228


>07_03_1175 -
           24555965-24556117,24557809-24558264,24558270-24558436,
           24558468-24558756,24559620-24559726,24559841-24559909,
           24560001-24560109
          Length = 449

 Score = 57.6 bits (133), Expect = 7e-09
 Identities = 31/90 (34%), Positives = 52/90 (57%), Gaps = 2/90 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           KLFVGGLS+ T    L+  FS YG+V++  ++ + ++G+S+G+GF+T+  ++ +   +  
Sbjct: 32  KLFVGGLSYATDDTTLKDVFSHYGDVLEARIIIDRDTGKSKGYGFITYTSSEEAAAAVTA 91

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
            +G   L GR +     N R      RGGG
Sbjct: 92  MDG-KDLQGRIVRVSTANDRA--GGIRGGG 118



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F  YG V+E  I+ D+   KS G GF+++
Sbjct: 51  FSHYGDVLEARIIIDRDTGKSKGYGFITY 79


>03_01_0160 + 1302366-1302731,1303318-1303364,1303455-1303800
          Length = 252

 Score = 57.6 bits (133), Expect = 7e-09
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 10/126 (7%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E GK+   GL + T++  ++  F R+G +    + +  +SG  RG  FV+F    +V   
Sbjct: 71  ETGKVVASGLPYTTTEAEIRELFERFGPLRSLQLSRFPDSGNFRGLAFVSFESNEVVMKS 130

Query: 260 LQNGPHQLDGRTIDPKPC-------NPRTLQ---KPKRGGGYPKVFLGGLPSNVTETDLR 409
           L+    ++  R +  + C         RT++    PK+  G    ++G L  +VTETDLR
Sbjct: 131 LELDGFKIGNRFMRVERCRLAAGSKRKRTVEFQTDPKKADGCLSAYVGNLKWDVTETDLR 190

Query: 410 XIFRTL 427
             F++L
Sbjct: 191 DFFKSL 196


>09_06_0308 -
           22199389-22199451,22199604-22199924,22200178-22200423,
           22202152-22203337,22203487-22203551,22204205-22204486,
           22205005-22205106,22205587-22206105
          Length = 927

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 36/121 (29%), Positives = 63/121 (52%), Gaps = 4/121 (3%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++  E+ K++VG L ++   E L + F + G V    V+ N E+ RSRGFGFVT +    
Sbjct: 137 VEPPEEAKVYVGNLPYDIDSERLAQLFEQAGIVEVSEVIYNRETDRSRGFGFVTMSTVEE 196

Query: 248 VNLVLQN-GPHQLDGRTIDPKPCNPR--TLQKPKRGGGYP-KVFLGGLPSNVTETDLRXI 415
               ++    + +DGR +      PR   +++P R  G   ++++G LP  V ++ L  +
Sbjct: 197 AEKAVEMFHRYDVDGRLLTVNKAAPRGARVERPPRQFGPSFRIYVGNLPWQVDDSRLVQL 256

Query: 416 F 418
           F
Sbjct: 257 F 257



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 23/49 (46%), Positives = 34/49 (69%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +++VG L W+     L + FS +G+V+D  V+ + E+GRSRGFGFVT A
Sbjct: 238 RIYVGNLPWQVDDSRLVQLFSEHGKVVDARVVYDRETGRSRGFGFVTMA 286



 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 24/73 (32%), Positives = 44/73 (60%)
 Frame = +2

Query: 92   LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
            ++VG L W+  +  L ++F  +G V+   V+ + ++GRSRGFGFV+ A     + V+ + 
Sbjct: 845  IYVGNLRWDVDRLRLLKFFGEHGRVLVAQVVCDRQTGRSRGFGFVSMATLREPDDVIAS- 903

Query: 272  PHQLDGRTIDPKP 310
               L+G+ +D +P
Sbjct: 904  ---LNGQIMDGRP 913



 Score = 29.1 bits (62), Expect = 2.7
 Identities = 11/29 (37%), Positives = 19/29 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           FFG +G+V+   ++ D+   +S G GF+S
Sbjct: 862 FFGEHGRVLVAQVVCDRQTGRSRGFGFVS 890



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 10/28 (35%), Positives = 19/28 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           F  +GKV++  ++YD+   +S G GF++
Sbjct: 257 FSEHGKVVDARVVYDRETGRSRGFGFVT 284


>02_05_1206 +
           34941293-34941562,34942052-34942153,34942249-34942521,
           34942863-34942913
          Length = 231

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 30/72 (41%), Positives = 43/72 (59%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLFVG LSW  + E L   F + G V+   V+ + E+GRSRG+GFV ++    ++  L  
Sbjct: 152 KLFVGNLSWTVTSEMLTEMFQKCGNVVGARVLYDGETGRSRGYGFVCYSTKEEMDEALSS 211

Query: 266 -NGPHQLDGRTI 298
            NG  +L+GR I
Sbjct: 212 LNGT-ELEGREI 222



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 34/116 (29%), Positives = 48/116 (41%), Gaps = 5/116 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL+ G L +      L      Y       V+ +  +GRSRGF FVT +       V++N
Sbjct: 61  KLYFGNLPYNCDSAQLAGIVQDYATPEMVEVLYDRATGRSRGFAFVTMSTIEDCEQVIKN 120

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPK-RGGGYP----KVFLGGLPSNVTETDLRXIFR 421
               LDG     +        KPK +   YP    K+F+G L   VT   L  +F+
Sbjct: 121 ----LDGSLYSGRTMRVNFADKPKPKLPLYPETEHKLFVGNLSWTVTSEMLTEMFQ 172


>03_02_0558 - 9459745-9459980,9460089-9460157,9460630-9460846
          Length = 173

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 33/84 (39%), Positives = 47/84 (55%), Gaps = 1/84 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQ 265
           KLF+ GLS  T+ E L+  F+ +G++++  V+ +  SGRS+GFGFV +A      N   +
Sbjct: 68  KLFISGLSRLTTDEKLKNAFAPFGQLLEAKVITDRISGRSKGFGFVRYATLEEAENARQE 127

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKP 337
                LDG  I   P  PR  QKP
Sbjct: 128 MNAKFLDGWVIFVDPAKPRQ-QKP 150


>03_05_0067 - 20460206-20460703,20461255-20461530
          Length = 257

 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 38/131 (29%), Positives = 65/131 (49%), Gaps = 4/131 (3%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           DE   L++G L +   +  L   FS+ GE+I   +++N ++G+  G+GF+ F   ++   
Sbjct: 64  DEVRTLWIGDLQFWMEENYLYNCFSQAGELISAKIIRNKQTGQPEGYGFIEFGSHAIAEQ 123

Query: 257 VLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRG--GGYPKVFLGGLPSNVTETDLRXIFRT 424
           VLQ  NG    +G  +  K     +    KRG  G    +F+G L S+VT+  L+  F+ 
Sbjct: 124 VLQGYNGQMMPNGNQVF-KLNWATSGAGEKRGDDGSDYTIFVGDLASDVTDLILQDTFKA 182

Query: 425 LWEGHGGGHYV 457
            ++   G   V
Sbjct: 183 HYQSVKGAKVV 193



 Score = 37.1 bits (82), Expect = 0.010
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYF-SRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           DD     +FVG L+ + +   LQ  F + Y  V    V+ +  +GRS+G+GFV F D
Sbjct: 155 DDGSDYTIFVGDLASDVTDLILQDTFKAHYQSVKGAKVVFDRSTGRSKGYGFVKFGD 211


>10_08_0154 +
           15266430-15266953,15267748-15267820,15267893-15267949,
           15268248-15268303,15269584-15269797,15270497-15270538,
           15270661-15270735,15270820-15270903,15271880-15271944,
           15272436-15272655,15272820-15272908,15273326-15273440,
           15273519-15273554
          Length = 549

 Score = 54.0 bits (124), Expect = 8e-08
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 8/127 (6%)
 Frame = +2

Query: 62  PDMDDD-EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           P+ D + ++  +F   LS +  + ++  +FSR G+V D  ++ +  S RS+G G++ F D
Sbjct: 184 PEADPERDQRTVFAFQLSLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYIEFYD 243

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCN-PRTLQKPK------RGGGYPKVFLGGLPSNVTE 397
              V + +      L G+ +  KP    + L +          GG  K+++G L SN+TE
Sbjct: 244 AMSVPMAIALTGQVLLGQQVMVKPSEAEKNLVQSNVASGGIASGGARKLYVGNLHSNITE 303

Query: 398 TDLRXIF 418
             LR +F
Sbjct: 304 DQLRQVF 310



 Score = 34.3 bits (75), Expect = 0.073
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF R GKV +V ++ D+  ++S G G++ F D  S
Sbjct: 212 FFSRAGKVRDVRLIMDRNSRRSKGVGYIEFYDAMS 246


>05_01_0112 -
           757514-758444,758525-758571,759074-759236,759861-760366
          Length = 548

 Score = 54.0 bits (124), Expect = 8e-08
 Identities = 34/121 (28%), Positives = 59/121 (48%), Gaps = 5/121 (4%)
 Frame = +2

Query: 71  DDDEKG--KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           ++ EK   K++VGG+ + +S+++++ +F   G +     M   ESG+ RG   +TF   +
Sbjct: 167 EESEKNAKKVYVGGIPYYSSEDDIRSFFEACGSITSVDCMTFPESGKFRGIAILTFKTDA 226

Query: 245 LVNLVLQNGPHQLDG--RTIDP-KPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXI 415
                L      + G    I P K    +    PK   GY +V++G L  ++TE DL+  
Sbjct: 227 AAQRALALDGADMGGFFLKIQPYKSVREKEDFAPKMIEGYNRVYVGNLAWDITEDDLKKF 286

Query: 416 F 418
           F
Sbjct: 287 F 287



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 18/90 (20%), Positives = 47/90 (52%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +++VG L+W+ ++++L+++FS   ++       + E+G  +G+  V F++ + V + ++ 
Sbjct: 268 RVYVGNLAWDITEDDLKKFFSDC-KISSIRFGTDKETGDFKGYVHVDFSEGTSVAVAMKL 326

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
               + GR +  +   P+   +   G   P
Sbjct: 327 DQKVIKGRPVRIRCAVPKKDNQKLNGNANP 356


>01_01_1143 - 9064210-9065682
          Length = 490

 Score = 54.0 bits (124), Expect = 8e-08
 Identities = 24/69 (34%), Positives = 39/69 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FV GL W+ + E L   FS YGE+ D  V+ +  +G+ +G+GF+ F+  S     L+ 
Sbjct: 157 KIFVHGLGWDATAETLTEAFSAYGEIEDLRVVTDRATGKCKGYGFILFSRRSGARAALRE 216

Query: 269 GPHQLDGRT 295
              ++  RT
Sbjct: 217 PQKKIGNRT 225



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 23/105 (21%), Positives = 47/105 (44%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P + +  + K+FV  +  +   + L ++FS+YGE+ +  +  +  +G+ +GF    +   
Sbjct: 259 PPVSEYTQRKIFVSNVGADIDPQKLLQFFSKYGEIEEGPLGLDKVTGKPKGFALFVYKTL 318

Query: 242 SLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
                 LQ    Q +G  +  +        KP +GGG   ++  G
Sbjct: 319 DSAKKALQEPHKQFEGVVLHCQKAIDG--PKPNKGGGLGGLYGAG 361


>03_02_0555 +
           9431451-9431688,9432685-9432803,9432886-9433079,
           9433174-9433430,9433544-9433650,9433715-9433888,
           9434359-9434490,9434776-9434955,9435062-9435265
          Length = 534

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +PD      G +FV  L+      +LQ  F ++G+++ C V KN E G SRG+GFV FA 
Sbjct: 105 DPDARRSGVGNVFVKNLNDLVDNVSLQELFCKFGDILSCKVAKN-EDGTSRGYGFVQFAL 163

Query: 239 PSLVNLVLQN-GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXI 415
               +  +QN       GR +       ++ +       Y  +++  L  ++TE  ++  
Sbjct: 164 QESADASIQNLNNSHFCGRQLHVATFIKKSERSTNNDDKYTNLYMKNLDDDITEELIKLK 223

Query: 416 F 418
           F
Sbjct: 224 F 224



 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 22/57 (38%), Positives = 37/57 (64%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           +DD+   L++  L  + ++E ++  FS+YG VI   +MK  + G S+GFGFV+F +P
Sbjct: 199 NDDKYTNLYMKNLDDDITEELIKLKFSQYGLVISVKIMKR-DDGTSKGFGFVSFQNP 254



 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 17/63 (26%), Positives = 34/63 (53%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +++  ++ E   + L+  F+ +G +    +M++ E G S+GFGFV +  P      ++N 
Sbjct: 309 VYIKNINDEVGDDALRERFNEFGNITSAKIMRD-EKGISKGFGFVCYNTPEEAKCAMRNT 367

Query: 272 PHQ 280
           P Q
Sbjct: 368 PRQ 370



 Score = 31.1 bits (67), Expect = 0.68
 Identities = 26/111 (23%), Positives = 45/111 (40%), Gaps = 2/111 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+VG L     +E+L   F + G +    V +++ +  S  +G+V +   +   + L+  
Sbjct: 28  LYVGDLHESVREEHLLEVFGKIGTLTSVRVCRDNATSNSLRYGYVNYLSQADAAIALEKL 87

Query: 272 PHQLDGRTIDPKPCNPRTLQK--PKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H L    I  KP       +    R  G   VF+  L   V    L+ +F
Sbjct: 88  NHSL----ILDKPIRVMWSNRDPDARRSGVGNVFVKNLNDLVDNVSLQELF 134


>05_04_0101 -
           18003528-18003655,18003951-18003997,18004046-18004077,
           18004316-18004453,18004579-18004619,18004967-18005105,
           18010981-18011057,18011804-18011858,18012976-18013021,
           18013099-18013187,18013304-18013417
          Length = 301

 Score = 53.2 bits (122), Expect = 1e-07
 Identities = 24/78 (30%), Positives = 40/78 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++FV  +     +   +R+F  +GE+ID  + K   S   RG GF+TF     V+ ++Q 
Sbjct: 51  RIFVARIPQSVDESKFRRHFEAFGEIIDLYMPKELRSKSHRGIGFITFRSAECVDNIMQE 110

Query: 269 GPHQLDGRTIDPKPCNPR 322
             H+LDG T+      P+
Sbjct: 111 -THELDGTTVAVDRATPK 127


>04_03_0876 + 20493213-20493339,20493574-20493642,20493745-20493890
          Length = 113

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 21/55 (38%), Positives = 36/55 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +LF+GGLS   ++++L   FS+YG+V++  ++ +  + R +GFGFV FA     N
Sbjct: 38  RLFIGGLSQFATEDSLAEAFSQYGQVLEATIVTDKMTNRPKGFGFVKFASEEAAN 92



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = +3

Query: 273 LINLMAGPSTLSRAILALFKNRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVI 452
           L++    P+  +R  L L  +R +   T R  + G  +   +      F +YG+V+E  I
Sbjct: 13  LVSRRESPAAYARPFL-LTHSRGI---TYRLFIGGLSQFATEDSLAEAFSQYGQVLEATI 68

Query: 453 MYDQXKKKSXGXGFLSFEDE 512
           + D+   +  G GF+ F  E
Sbjct: 69  VTDKMTNRPKGFGFVKFASE 88


>10_05_0029 -
           8319233-8319408,8319516-8319584,8319754-8319838,
           8320112-8320225
          Length = 147

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 22/44 (50%), Positives = 33/44 (75%)
 Frame = +2

Query: 101 GGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           GG+S+ T  ++L+  F+ YGEVI+  V+ +  +GRSRGFGFVT+
Sbjct: 66  GGISYGTDDQSLKEAFANYGEVIEARVIVDRTTGRSRGFGFVTY 109



 Score = 28.3 bits (60), Expect = 4.8
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F  YG+V+E  ++ D+   +S G GF+++
Sbjct: 81  FANYGEVIEARVIVDRTTGRSRGFGFVTY 109


>08_01_0620 -
           5416197-5416225,5416333-5416652,5417144-5417235,
           5417304-5417394,5417489-5417577,5417812-5417929,
           5418007-5418098,5418180-5418215,5418323-5418403,
           5418510-5418617,5418809-5418901,5419045-5419146,
           5419345-5419449,5419526-5419612,5419952-5420227
          Length = 572

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 38/122 (31%), Positives = 56/122 (45%), Gaps = 12/122 (9%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E   LF+G LS+  +Q+ ++ +F   GEVI  V +   E G SRGFG V FA        
Sbjct: 309 ESATLFMGNLSFNLNQDQVKEFFQEVGEVIS-VRLATHEDGSSRGFGHVQFASSEEAKKA 367

Query: 260 LQNGPHQLDGRTIDPKPCNPR------------TLQKPKRGGGYPKVFLGGLPSNVTETD 403
           L+     LDGR +     + R            + QK  RG     +F+ G  S++ E+ 
Sbjct: 368 LELHGCDLDGRPVRLDLAHERGAYTPHSRNDTGSFQKQNRGSS-QSIFVKGFDSSLEESK 426

Query: 404 LR 409
           +R
Sbjct: 427 IR 428



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 22/88 (25%), Positives = 39/88 (44%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K F   L     +E+L+ +F+  GE+    V  + E+G S+G  ++ F D +  +  L+ 
Sbjct: 416 KGFDSSLEESKIRESLEGHFADCGEITRVSVPMDRETGASKGIAYIDFKDQASFSKALEL 475

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
               L G  +      P+     + GGG
Sbjct: 476 SGSDLGGYNLYVDEAKPK--GDSRDGGG 501


>03_01_0373 -
           2904914-2904949,2905030-2905144,2906446-2906534,
           2906670-2906889,2907921-2907985,2908619-2908879,
           2909204-2909417,2910643-2910698,2910891-2910947,
           2911043-2911115,2912711-2913225
          Length = 566

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 35/128 (27%), Positives = 60/128 (46%), Gaps = 8/128 (6%)
 Frame = +2

Query: 62  PDMDDD-EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           P+ D + ++  +F   LS +  + ++  +FSR G+V D  ++ +  S RS+G G++ F D
Sbjct: 181 PEADPERDQRTVFAYQLSLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYIEFYD 240

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKP-------CNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
              V + +      L G+ +  KP                   GG  K+++G L SN+TE
Sbjct: 241 VMSVPMAIALSGQLLLGQQVMVKPSEAEKNLVQSNASSSGAASGGARKLYVGNLHSNITE 300

Query: 398 TDLRXIFR 421
             LR   R
Sbjct: 301 DQLRQFAR 308



 Score = 33.9 bits (74), Expect = 0.097
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF R GKV +V ++ D+  ++S G G++ F D  S
Sbjct: 209 FFSRAGKVRDVRLIMDRNSRRSKGVGYIEFYDVMS 243


>07_03_0824 +
           21769569-21769689,21770891-21770959,21771047-21771153,
           21771310-21771414
          Length = 133

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D    LFV GL+  T+ + L+  FS++G+VI+  V+ +  SG SRGFGFV +A       
Sbjct: 32  DPCNNLFVSGLNKRTTSDGLREAFSKFGQVIEARVITDRISGYSRGFGFVKYATVEEAGE 91

Query: 257 VLQNGPHQ-LDGRTIDPKPCNPRTLQKP 337
            ++    + LDG  I  +    R  Q+P
Sbjct: 92  GIKGMDGKFLDGWVIFAEYAKQREAQQP 119


>05_03_0023 + 7457836-7457976,7458313-7458480
          Length = 102

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +++VG L +   ++ L  YF+ YG  I   +  +SE GR RGFGFV F D   VN  +  
Sbjct: 19  RVYVGNLPYSVDEQTLMDYFADYG-AISAEIAWDSEMGRPRGFGFVNFEDNESVNAAI-- 75

Query: 269 GPHQLDGRTIDPKPCN-PRTLQKPKR 343
             H ++G+ I  +     R   +P+R
Sbjct: 76  --HGMNGQDIGGRKVTVARAQMRPRR 99


>04_04_1188 +
           31579833-31579914,31580001-31580176,31580822-31580923,
           31581015-31581245,31581821-31581922,31582092-31582184,
           31582275-31582379,31582455-31582514,31582621-31582698,
           31582778-31582924,31583011-31583109,31583178-31583267,
           31583360-31583451,31583529-31583646,31583783-31583871,
           31583998-31584088,31584203-31584294,31584442-31584749,
           31584866-31584897
          Length = 728

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 26/69 (37%), Positives = 35/69 (50%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           LFVG L +   QE ++++F   GEV+D +     E G  RGFG V FA        L+  
Sbjct: 472 LFVGNLPYNVEQEQVKQFFQEAGEVVD-IRFSTFEDGNFRGFGHVEFATAEAAKKALELA 530

Query: 272 PHQLDGRTI 298
            H L GR +
Sbjct: 531 GHDLMGRPV 539



 Score = 34.3 bits (75), Expect = 0.073
 Identities = 19/77 (24%), Positives = 36/77 (46%)
 Frame = +2

Query: 125 QENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDP 304
           + +L+ +F   GE+    + K+ E+G S+G  ++ FAD   ++   +     L G ++  
Sbjct: 587 RNSLEEHFGSCGEITRVSIPKDYETGASKGMAYMDFADNGSLSKAYELNGSDLGGYSLYV 646

Query: 305 KPCNPRTLQKPKRGGGY 355
               PR      R GG+
Sbjct: 647 DEARPR--PDNNREGGF 661


>03_02_0472 -
           8737955-8738580,8738704-8738767,8739090-8739239,
           8739311-8739422,8739686-8739708
          Length = 324

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGK-LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGF 223
           G R     D +  G  L+V GLS   +  +L+++FS  GEVID  ++ +  +  SRGFGF
Sbjct: 6   GSRSVDSSDVENPGNNLYVTGLSARVTDRDLEKHFSAEGEVIDASIVLDPWTRESRGFGF 65

Query: 224 VTFADPSLVNLVLQNGPHQ-LDGRTIDPKPCNPRTLQKPKRG 346
           VT A     +L ++      L+GR I  +    R  + P  G
Sbjct: 66  VTMATVKEADLCIKYLDRSVLEGRVITVEKAKRRRGRTPTPG 107


>05_03_0025 + 7462272-7462412,7462865-7463032
          Length = 102

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 2/80 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +++VG L +  +  +L+  F+ YG  I   +  +S  GRSRGFGFV F D   VN  +Q 
Sbjct: 19  RVYVGNLPFSANDRSLKDSFANYG-AISAEIAWDSVMGRSRGFGFVNFEDSESVNAAIQG 77

Query: 266 -NGPHQLDGRTIDPKPCNPR 322
            NG   + GR +     N R
Sbjct: 78  MNG-QDIGGRNVTVAQANTR 96



 Score = 27.9 bits (59), Expect = 6.3
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F  YG +    I +D    +S G GF++FED  S
Sbjct: 38  FANYGAI-SAEIAWDSVMGRSRGFGFVNFEDSES 70


>05_03_0022 + 7452234-7452389,7452955-7453113
          Length = 104

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 27/84 (32%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           ++ +++VG L +   + +L+  FS YG V   + + + E+GRSRGFGFV+F D    +  
Sbjct: 21  QESRVYVGNLPYRADERSLKDSFSNYGAVSSEIAV-DRETGRSRGFGFVSFQDSKSASDA 79

Query: 260 LQ--NGPHQLDGRTIDPKPCNPRT 325
           ++  NG   + GR +  +   PR+
Sbjct: 80  IKGMNG-QDIGGRNVIVQEAQPRS 102



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F  YG V   + + D+   +S G GF+SF+D  S
Sbjct: 43  FSNYGAVSSEIAV-DRETGRSRGFGFVSFQDSKS 75


>08_01_0118 +
           947394-947885,948709-948810,948914-949219,949557-949616
          Length = 319

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 21/70 (30%), Positives = 38/70 (54%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++VG ++W    + L+ YFS+ G V+   ++ + + GR R +GF++FA    +   L+ 
Sbjct: 238 KIYVGNIAWSVEPQELREYFSQCGTVVSTRLLTDRKGGRGRVYGFLSFASAEELEAALKL 297

Query: 269 GPHQLDGRTI 298
                 GR I
Sbjct: 298 DNTHFHGRNI 307



 Score = 37.1 bits (82), Expect = 0.010
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQ 265
           +LFV  L      ++L   F  YG V+   + ++ E+G SRG GFVT    P     +  
Sbjct: 135 ELFVCNLPRRCDVDDLYELFKPYGTVLSVEISRDPETGLSRGCGFVTMRSLPEARTAMNA 194

Query: 266 NGPHQLDGR 292
                LDGR
Sbjct: 195 LDGFDLDGR 203


>03_06_0523 +
           34499533-34499705,34499808-34499917,34500037-34500224,
           34500984-34501451
          Length = 312

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 19/59 (32%), Positives = 39/59 (66%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FVGG+ ++ ++ +L   F++YGEV+D  ++++  +G+S+GF F+ + D     L + N
Sbjct: 38  VFVGGIPYDLTEGDLLAVFAQYGEVVDVNLVRDKGTGKSKGFAFLAYEDQRSTILAVDN 96



 Score = 34.7 bits (76), Expect = 0.055
 Identities = 14/34 (41%), Positives = 24/34 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG+V++V ++ D+   KS G  FL++ED+ S
Sbjct: 56  FAQYGEVVDVNLVRDKGTGKSKGFAFLAYEDQRS 89


>10_01_0298 -
           3094197-3094307,3095093-3095253,3095462-3095666,
           3096349-3096534,3096616-3096756,3096843-3096959,
           3097046-3097456
          Length = 443

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 30/112 (26%), Positives = 61/112 (54%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++F+GGL  +T++++L      +GE+ +  +MK+ E+  ++GF FVTF         +++
Sbjct: 110 EVFIGGLPRDTTEDDLHELCEAFGEISEVRLMKDKETKENKGFAFVTFTGKDGAQRAIED 169

Query: 269 -GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
               +  GRT+    C   +L + K      ++F+G +P  ++E +LR I +
Sbjct: 170 LHDKEHKGRTL---RC---SLSQAKH-----RLFVGNVPKGLSEDELRNIIQ 210



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 4/93 (4%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQN 268
           ++V  L    S+E ++  F  +GEV   VV+  +++G  R FGFV FA+  S +  V  +
Sbjct: 289 IYVKNLPENASKEKIKEIFEIHGEVTK-VVLPPAKAGNKRDFGFVHFAERSSALKAVKGS 347

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPK---RGGGYP 358
             +++DG+ ++     P   +KP    + GG P
Sbjct: 348 EKYEIDGQVLEVSMAKPLGDKKPDHSFKPGGAP 380


>09_04_0424 +
           17444261-17444665,17445974-17446367,17447367-17447425,
           17447507-17447637,17447737-17447833,17447936-17448100
          Length = 416

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 3/130 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E   ++VG L +   +  L   F   GEV+   V++N ++G+S G+GFV F   +    
Sbjct: 107 EENKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEK 166

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP---KVFLGGLPSNVTETDLRXIFRTL 427
           VL+     +   T  P   N  +     R         +F+G L S+V +T L   F   
Sbjct: 167 VLEGFAGHIMPNTDQPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKR 226

Query: 428 WEGHGGGHYV 457
           +    G   V
Sbjct: 227 YSSVKGAKVV 236



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 36/110 (32%), Positives = 54/110 (49%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FVG L+ + +   L   FS RY  V    V+ ++ +GRS+G+GFV F D +     +  
Sbjct: 205 IFVGDLASDVNDTTLLETFSKRYSSVKGAKVVIDANTGRSKGYGFVRFGDDNEKTHAMT- 263

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
              +++G T  P     R+            VF+GGL  NV+E DLR  F
Sbjct: 264 ---EMNG-TSGPTGSAARSDGDLTN----TTVFVGGLDPNVSEDDLRQTF 305



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG 202
           +FVGGL    S+++L++ FS+YGE+    +    + G
Sbjct: 287 VFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQCG 323


>08_01_0268 -
           2167639-2167764,2167887-2167937,2169126-2169167,
           2169343-2169449,2169536-2169604,2170542-2170665
          Length = 172

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 23/58 (39%), Positives = 35/58 (60%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           P    D    LF+ GLS  T+ + L+  F+++GEVI   V+ +  +G S+GFGFV +A
Sbjct: 28  PPPKADPSPNLFISGLSKRTTTDGLKEAFAKFGEVIHARVVTDRVTGFSKGFGFVRYA 85


>11_02_0073 -
           8020401-8020512,8020594-8020679,8020761-8020921,
           8021196-8021400,8021664-8021697,8022352-8022422,
           8023363-8023542,8023625-8023765,8023859-8023975,
           8024074-8024469
          Length = 500

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 31/112 (27%), Positives = 61/112 (54%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVNLVLQ 265
           ++F+GGL  +T++E+L+     +GE+ +  +MK+ E+  ++GF FV F A  +    + +
Sbjct: 105 EVFIGGLPRDTTEEDLRELCDSFGEIYEVRLMKDKETKENKGFAFVNFTAKEAAQRAIEE 164

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
               +  GRT+    C   +L + K      ++F+G +P  + E +LR I +
Sbjct: 165 LHDKEHKGRTL---RC---SLSQAKH-----RLFVGNVPKGLGEEELRKIIQ 205



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQN 268
           ++V  L    S+E ++  F ++GEV   VV+  ++ G  R FGFV FA+  S +  V  +
Sbjct: 317 IYVKNLPENASKEKIKEIFEKHGEVTK-VVLPPAKDGHKRDFGFVHFAERSSALKAVKGS 375

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP 337
             ++ +G+ ++     P   +KP
Sbjct: 376 EKYEFNGQVLEVSMAKPLGDKKP 398


>11_01_0236 +
           1811822-1812971,1814930-1814979,1815676-1816116,
           1816199-1816309,1816934-1817074,1817153-1817323,
           1817421-1817625,1817714-1817886,1817997-1818079,
           1818487-1818626,1818806-1818891,1818957-1819142,
           1819172-1819365,1820387-1820736,1821153-1821235
          Length = 1187

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N  +   +   ++V  L    +Q  L+R F  +GE I+ VV+  S  G    +GFV F D
Sbjct: 681 NDSVSTSQVKSVYVKNLPKNVTQAQLKRLFEHHGE-IEKVVLPPSRGGHDNRYGFVHFKD 739

Query: 239 PSLVNLVLQNGP-HQLDGRTIDPKPCNPRTLQK 334
            S+    LQN   ++LDG+ +D     P    K
Sbjct: 740 RSMAMRALQNTERYELDGQVLDCSLAKPPAADK 772



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 30/107 (28%), Positives = 54/107 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +++VGG+S + S E+L+R     GEV++  +M+  +   SRG+ FV F    L   V++ 
Sbjct: 520 EVYVGGISSDVSSEDLKRLCEPVGEVVEVRMMRGKDD--SRGYAFVNFRTKGLALKVVK- 576

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLR 409
              +L+   +  K     + Q         K+F+G +P + T+ D R
Sbjct: 577 ---ELNNAKLKGKRIRVSSSQAKN------KLFIGNVPHSWTDDDFR 614



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 4/116 (3%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGE-VIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           K KLF+G +    + ++ ++     G  V+   +MK S + R+RG+GFV + + +     
Sbjct: 596 KNKLFIGNVPHSWTDDDFRKAVEEVGPGVLKADLMKVSSANRNRGYGFVEYYNHACAEYA 655

Query: 260 LQ--NGP-HQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            Q  + P  +LD         +P+             V++  LP NVT+  L+ +F
Sbjct: 656 RQEMSSPTFKLDSNAPTVSWADPKNNDSVST-SQVKSVYVKNLPKNVTQAQLKRLF 710


>04_04_0053 +
           22389227-22389613,22390528-22390981,22391618-22391673,
           22391757-22391887,22391976-22392072,22393329-22393484
          Length = 426

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 33/130 (25%), Positives = 56/130 (43%), Gaps = 3/130 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E   ++VG L +   +  L   F   GEV+   V++N ++G+S G+GFV F        
Sbjct: 101 EENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFYSHGSAEK 160

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTL---QKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTL 427
            LQN    +   T  P   N  +    +K         +F+G L ++VT+  L  +F   
Sbjct: 161 ALQNFTGHVMPNTDRPFKLNWASYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFANK 220

Query: 428 WEGHGGGHYV 457
           +    G   +
Sbjct: 221 YRSVKGAKVI 230



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 39/121 (32%), Positives = 58/121 (47%), Gaps = 12/121 (9%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN--LVL 262
           +FVG L+ + + E L   F+ +Y  V    V+ ++ +GRSRG+GFV F D +  +  +  
Sbjct: 199 IFVGDLAADVTDEMLMELFANKYRSVKGAKVIIDANTGRSRGYGFVRFGDDNDKSHAMTE 258

Query: 263 QNGPHQLDGRTIDPKPCNPRT------LQKPKRGGG---YPKVFLGGLPSNVTETDLRXI 415
            NG +    R I   P  PR          P    G      V++GGL  NV+E +LR  
Sbjct: 259 MNGAY-CSTRPIRIGPATPRRSSGDSGSSTPGHSDGDSTNRTVYVGGLDPNVSEDELRKA 317

Query: 416 F 418
           F
Sbjct: 318 F 318



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG 202
           D     ++VGGL    S++ L++ F++YG+V    +    + G
Sbjct: 294 DSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCG 336


>01_06_0006 -
           25517892-25517935,25518156-25518276,25518598-25518733,
           25519189-25519280,25519358-25519426,25519710-25519821,
           25519897-25520015,25520302-25520355,25520811-25520891,
           25520968-25521051,25521124-25521315,25521633-25521746,
           25521832-25521978,25522066-25522302,25522762-25522810,
           25522894-25523027,25523124-25523324,25523532-25523701,
           25523773-25523875,25524198-25524361,25525015-25525055,
           25525144-25525187
          Length = 835

 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 22/67 (32%), Positives = 35/67 (52%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D     ++ + GL W  S +++  +FS YG V+D  + +  E+  S G GFV F+    V
Sbjct: 99  DKKTNRRITLDGLPWTVSNDDIVHFFSPYGTVVDHQITQKDENKLSEGSGFVLFSSELAV 158

Query: 251 NLVLQNG 271
             +L NG
Sbjct: 159 IKILSNG 165



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 27/113 (23%), Positives = 60/113 (53%), Gaps = 2/113 (1%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           G++ + GL  E S  +L  YF +YG+++D ++++   + ++     +T+AD ++ + +++
Sbjct: 15  GQVVIRGLPSELSYADLADYFIKYGKIVDLIIIRAKGTAQAGDSAKITYADAAISDKIIK 74

Query: 266 NGPHQLDGR-TIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
              H + G+  +  +     T+Q K K+     ++ L GLP  V+  D+   F
Sbjct: 75  -CRHIIKGKHVVVDRTLMEDTIQYKDKKTN--RRITLDGLPWTVSNDDIVHFF 124



 Score = 27.9 bits (59), Expect = 6.3
 Identities = 17/51 (33%), Positives = 22/51 (43%)
 Frame = +3

Query: 360 RCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           R +L G   T+       FF  YG V++  I      K S G GF+ F  E
Sbjct: 105 RITLDGLPWTVSNDDIVHFFSPYGTVVDHQITQKDENKLSEGSGFVLFSSE 155


>12_01_0234 +
           1755704-1756120,1756203-1756313,1756923-1757063,
           1757142-1757312,1757412-1757616,1757738-1757910,
           1758021-1758103,1758250-1758389,1758569-1758645,
           1758711-1758810,1759978-1760606
          Length = 748

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 29/93 (31%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N      +   ++V  L    +Q  L+R F  +GE I+ VV+  S  G    +GFV F D
Sbjct: 273 NDSASTSQVKSVYVKNLPKNVTQAQLKRLFEHHGE-IEKVVLPPSRGGHDNRYGFVHFKD 331

Query: 239 PSLVNLVLQNGP-HQLDGRTIDPKPCNPRTLQK 334
            S+    LQN   ++LDG+ +D     P    K
Sbjct: 332 RSMAMRALQNTERYELDGQVLDCSLAKPPAADK 364



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 1/117 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL-VNLVLQ 265
           +++VGG+S + S E+L+R     GEV++  +M+  +   SRG+ FV F    L +  V +
Sbjct: 112 EVYVGGISSDVSSEDLKRLCEPVGEVVEVRMMRGKDD--SRGYAFVNFRTKGLALKAVKE 169

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEG 436
               +L G+ I       +            K+F+G +P + T+ D R +   +  G
Sbjct: 170 LNNAKLKGKRIRVSSSQAKN-----------KLFIGNVPHSWTDDDFRKVVEEVGPG 215



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 4/116 (3%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGE-VIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           K KLF+G +    + ++ ++     G  V+   +MK S + R+RG+GFV + + +     
Sbjct: 188 KNKLFIGNVPHSWTDDDFRKVVEEVGPGVLKADLMKVSSANRNRGYGFVEYYNHACAEYA 247

Query: 260 LQ--NGP-HQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            Q  + P  +LD         +P+             V++  LP NVT+  L+ +F
Sbjct: 248 RQEMSSPTFKLDSNAPTVSWADPKNNDSAST-SQVKSVYVKNLPKNVTQAQLKRLF 302


>04_04_0979 -
           29862280-29862444,29862718-29862999,29863831-29863929,
           29864037-29864366
          Length = 291

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ KL+V  L W+    N++ +FS++   +   V+ +S SG+S G+GFV+F         
Sbjct: 172 ERHKLYVSNLPWKARAPNMKEFFSKFNP-LSAKVVFDSPSGKSAGYGFVSFGTKEEAEAA 230

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQ 331
           L     +LDG+ +  +P   R  Q
Sbjct: 231 LT----ELDGKELMGRPVRLRWRQ 250



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +++ KL+V  + W      +++ F++ G V D  V+K  + G+ +GF FVT A
Sbjct: 77  EKRRKLYVANIPWSFPAPEIEKLFAQCGAVKDVEVIKGKD-GKKKGFAFVTMA 128


>04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066
          Length = 646

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN-- 253
           ++  L++G L        L   FS++GE++   V+++  +G+S+G+GFV ++D S  N  
Sbjct: 305 DETNLYIGYLPPTLDDSGLIGLFSQFGEIVMAKVIRDRITGQSKGYGFVKYSDVSQANAA 364

Query: 254 LVLQNGPHQLDGRTI 298
           +   NG H L+GR I
Sbjct: 365 IAAMNGYH-LEGRVI 378


>09_02_0211 -
           5817564-5817578,5817711-5818040,5818095-5818196,
           5818616-5818915
          Length = 248

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 20/53 (37%), Positives = 34/53 (64%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           D + K++VG L+   + E L+ +FS  GEV+   V +   + +S+G+GFVTF+
Sbjct: 177 DSQYKVYVGNLAKSVTTEMLKNFFSEKGEVLSATVSRIPGTAKSKGYGFVTFS 229



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 24/69 (34%), Positives = 38/69 (55%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL+VG +    + + L   F+ +G V    VM +  +GRSR FGFVT + P   N  +++
Sbjct: 71  KLYVGNIPRTVTNDELAAMFADHGTVERAEVMFDKYTGRSRRFGFVTMSTPEEANAAIES 130

Query: 269 GPHQLDGRT 295
             ++ D RT
Sbjct: 131 -LNETDMRT 138


>08_02_0526 +
           18184146-18184168,18184247-18184438,18184846-18184954,
           18185071-18185220,18185973-18186136,18186273-18186359,
           18187083-18187137,18187911-18188333
          Length = 400

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 3/64 (4%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKG---KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGF 217
           G   +   DDD +     L+V GLS   ++E+L+++FS+ G+V  C V+ +  +  SRGF
Sbjct: 67  GRSRSRSRDDDLRNPGNNLYVTGLSTRVTEEDLEKFFSKEGKVQSCHVVLDPRTKESRGF 126

Query: 218 GFVT 229
            FVT
Sbjct: 127 AFVT 130


>07_01_0413 -
           3155080-3155274,3155628-3155933,3156062-3156163,
           3156262-3156705
          Length = 348

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/79 (32%), Positives = 39/79 (49%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD   K++ G L W    + L+  F     ++D  V+   +SGRSRGFGFV+F       
Sbjct: 216 DDGTFKIYAGNLGWGVRADALRAAFEGQPGLLDARVIFERDSGRSRGFGFVSFRTAEDAQ 275

Query: 254 LVLQNGPHQLDGRTIDPKP 310
             L+     LDG  ++ +P
Sbjct: 276 AALE----ALDGVELEGRP 290



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E G+LFVG L +  +   + + FS  G V +  ++ +  + RSRGF FVT A        
Sbjct: 116 EPGRLFVGNLPYTMTSGEISQTFSEAGRVDNVQIIYDKVTDRSRGFAFVTMATAEEAATA 175

Query: 260 LQ--NGPHQLDGRT 295
           +Q  NG   L GRT
Sbjct: 176 IQMFNGA-LLGGRT 188


>02_04_0289 +
           21615745-21616155,21617417-21617870,21618162-21618217,
           21618307-21618437,21618565-21618727
          Length = 404

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 12/121 (9%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSR-YGEVIDCVVMKNSESGRSRGFGFVTFADPS-LVNLVLQ 265
           +FVG L+ + + E L   F++ Y  V    V+ ++ +GRSRG+GFV F D +   + + +
Sbjct: 207 IFVGDLAVDVTDEMLMDLFAKKYRSVKGAKVIIDANTGRSRGYGFVRFGDDNDKTHAMTE 266

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK----------VFLGGLPSNVTETDLRXI 415
                   R I   P  PR       G   P+          +++GGL  N TE +LR  
Sbjct: 267 MNGAYCSTRPIRIGPATPRR-SSGDSGSSPPRQSDSDSTNRTIYVGGLDPNATEDELRKA 325

Query: 416 F 418
           F
Sbjct: 326 F 326



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 23/64 (35%), Positives = 32/64 (50%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           DE   ++VG L +   +  L   F   GEV+   V++N  SG S G+GFV F   +    
Sbjct: 109 DENRTIWVGDLQYWMDEGYLHNCFGPSGEVVTIKVIRNRHSGVSEGYGFVEFFSHASAEK 168

Query: 257 VLQN 268
            LQN
Sbjct: 169 ALQN 172



 Score = 28.3 bits (60), Expect = 4.8
 Identities = 10/43 (23%), Positives = 23/43 (53%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG 202
           D     ++VGGL    +++ L++ F++YG++    +    + G
Sbjct: 302 DSTNRTIYVGGLDPNATEDELRKAFAKYGDLASVKIPVGKQCG 344


>08_02_0162 +
           13464698-13464974,13465719-13465837,13465920-13466579,
           13466686-13466763,13466849-13466938,13467241-13467378,
           13467730-13467738
          Length = 456

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 24/72 (33%), Positives = 42/72 (58%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++V  LS  T+++NL+  F ++G +   VVM+  + G+SR FGFV F +P      +++ 
Sbjct: 220 VYVKNLSESTTEDNLKEIFGKFGPITSVVVMREGD-GKSRCFGFVNFENPDDAARAVED- 277

Query: 272 PHQLDGRTIDPK 307
              L+G+  D K
Sbjct: 278 ---LNGKKFDDK 286



 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 8/131 (6%)
 Frame = +2

Query: 50  MRMNPDMDDDEKG--KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGF 223
           M  N D    + G   +F+  L      + L   FS +G ++ C V     SG S+G+GF
Sbjct: 113 MYSNRDPSSRKSGAANIFIKNLDKSIDNKALYDTFSVFGNILSCKVATEM-SGESKGYGF 171

Query: 224 VTFADPSLVNLVLQNGPHQLDGRTIDPKP--CNPRTLQKPKRG-GGYPK---VFLGGLPS 385
           V F     +    QN   +L+G  ++ K     P   ++ +    G PK   V++  L  
Sbjct: 172 VQFE----LEEAAQNAISKLNGMLLNDKKVYVGPFVRKQERENVSGNPKFNNVYVKNLSE 227

Query: 386 NVTETDLRXIF 418
           + TE +L+ IF
Sbjct: 228 STTEDNLKEIF 238


>09_01_0079 -
           1159963-1160211,1160303-1160509,1160631-1160801,
           1161732-1161869,1162184-1162273,1162354-1162431,
           1162510-1163166,1163245-1163363,1164305-1164584
          Length = 662

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 24/72 (33%), Positives = 41/72 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++V  LS  T++++L+  F ++G +   VVM+  + GRS+ FGFV F  P      +Q  
Sbjct: 221 VYVKNLSENTTEDDLKEIFGKFGTITSAVVMREGD-GRSKCFGFVNFESPDDAAQAVQ-- 277

Query: 272 PHQLDGRTIDPK 307
             +L+G+  D K
Sbjct: 278 --ELNGKKFDDK 287



 Score = 38.3 bits (85), Expect = 0.004
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 6/126 (4%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +       +F+  L      + L   F  +G ++ C V  ++ SG S+G+GFV +  
Sbjct: 119 DPSLRKSGTANIFIKNLDKSIDNKALYDTFCVFGNILSCKVATDA-SGESKGYGFVQYER 177

Query: 239 PSLVNLVLQNGPHQLDGRTI-DPKPCNPRTLQKPKRGGG-----YPKVFLGGLPSNVTET 400
                  +     +L+G  + D K      ++K +R        +  V++  L  N TE 
Sbjct: 178 DEAAQAAID----KLNGMLMNDKKVYVGPFIRKQERDNSPGQVKFNNVYVKNLSENTTED 233

Query: 401 DLRXIF 418
           DL+ IF
Sbjct: 234 DLKEIF 239


>08_02_1064 -
           24033941-24034127,24034432-24034476,24035355-24035421,
           24035521-24035600,24035691-24035769,24035864-24035939
          Length = 177

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 27/80 (33%), Positives = 42/80 (52%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           PD+ D     L V  +S+ T+ ++L   F RYG+V+D  + ++  +G SRGF FV +   
Sbjct: 10  PDIRDTFS--LLVLNISFRTTADDLFPLFDRYGKVVDVFIPRDRRTGDSRGFAFVRYKYA 67

Query: 242 SLVNLVLQNGPHQLDGRTID 301
                  Q    +LDGR +D
Sbjct: 68  E----EAQKAIDRLDGRNVD 83


>07_03_0600 + 19866757-19867218,19867920-19868429
          Length = 323

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 36/141 (25%), Positives = 61/141 (43%), Gaps = 5/141 (3%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCV-VMKNSESGRSRGFGFV 226
           M   P    DE   L++G L +   +  L   F+  G+ +  V V++N +SG S G+GF+
Sbjct: 116 MAGGPAPGGDEIRSLWIGDLQYWMDESYLSNAFAPMGQQVTSVKVIRNKQSGHSEGYGFI 175

Query: 227 TFADPSLVNLVLQN--GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK--VFLGGLPSNVT 394
            F   +     L N  G   L+   +           + +     P+  +F+G L S+VT
Sbjct: 176 EFQSHAAAEYALANFNGRMMLNVDQLFKLNWASSGAGERRAADDGPEHTIFVGDLASDVT 235

Query: 395 ETDLRXIFRTLWEGHGGGHYV 457
           ++ L   F+T +    G   V
Sbjct: 236 DSMLEEAFKTSYPSVRGAKVV 256



 Score = 38.3 bits (85), Expect = 0.004
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYF-SRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           DD  +  +FVG L+ + +   L+  F + Y  V    V+ +  +GRS+G+GFV F D
Sbjct: 218 DDGPEHTIFVGDLASDVTDSMLEEAFKTSYPSVRGAKVVFDKVTGRSKGYGFVRFGD 274


>06_03_0614 -
           22753092-22753349,22754059-22754277,22754712-22754960,
           22755186-22755275,22755379-22755456,22755562-22756337,
           22757042-22757384
          Length = 670

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 26/73 (35%), Positives = 42/73 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L++  L  + + E+L++ F  +GEV  C VM +S  GRS+G GFV+FA     N    N 
Sbjct: 345 LYLKNLDDDINDEHLRKLFECFGEVASCKVMLDSH-GRSKGCGFVSFATVEDAN----NA 399

Query: 272 PHQLDGRTIDPKP 310
             +++G+ +  KP
Sbjct: 400 ILKMNGKMVGKKP 412



 Score = 31.5 bits (68), Expect = 0.52
 Identities = 15/62 (24%), Positives = 30/62 (48%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +       +F+  L      ++L   FS +G ++   V  +  +G+S+G+GF+ F  
Sbjct: 140 DPTLRKSGLANVFIKNLEPNIDNKSLYEMFSSFGTILSSKVATDF-NGKSKGYGFIQFES 198

Query: 239 PS 244
            S
Sbjct: 199 ES 200


>04_04_1627 - 34867557-34870095,34870159-34870391,34871274-34871276
          Length = 924

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLV 250
           + +  KL+V  LS   + + L   F  +GEV +  V K+  +G S+G+GFV ++ P    
Sbjct: 300 ETDMAKLYVCNLSLSMNTDRLIHLFLPFGEVTNAKVAKDHTTGLSKGYGFVQYSSPHHAA 359

Query: 251 NLVLQNGPHQLDGRTIDPKPCN-PRTL 328
             V+      +DGR I+ +    P TL
Sbjct: 360 EAVIHLNGRLVDGRKIEVRVSGIPSTL 386



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 7/89 (7%)
 Frame = +2

Query: 56  MNPDMDDDEKGK-----LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFG 220
           +   M  +E+G+     L+V  L    + E L   F   G++    V+    +G S+GFG
Sbjct: 685 LTSQMSSNEQGQIDMTNLYVSHLPSYVNNERLIDLFLPCGQITQAKVVVERYTGVSKGFG 744

Query: 221 FVTFAD--PSLVNLVLQNGPHQLDGRTID 301
           FV FAD   + V L   NG + LDG  ++
Sbjct: 745 FVKFADAYSAAVALTHMNG-YPLDGHVLE 772



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 18/70 (25%), Positives = 38/70 (54%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+VG L        L   F  +G+++   V+ +  +G S+G+GFV ++DP   +  ++  
Sbjct: 211 LYVGNLPASVGSHKLIELFLPFGQIVRSRVVDDCFTGLSQGYGFVKYSDPRCASEAIK-- 268

Query: 272 PHQLDGRTID 301
             +++GR ++
Sbjct: 269 --RMNGRLVE 276



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 28/123 (22%), Positives = 54/123 (43%), Gaps = 7/123 (5%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLV 250
           D  K +L++  L    + + +   F+ +G++    V+ N E      +  V +AD PS  
Sbjct: 509 DINKSRLYITNLPRSMTADKMVNLFAPFGQITK--VLMNLE------YSLVWYADAPSAT 560

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK------VFLGGLPSNVTETDLRX 412
             V     + ++G+ +  K     T    + GG   K      +++G +PS++TE     
Sbjct: 561 KAVQHMDGYMVEGKRLVVKRSELCTTNASQAGGKPIKEIDMANLYVGRVPSSLTEDQFID 620

Query: 413 IFR 421
           +FR
Sbjct: 621 LFR 623



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 11/53 (20%), Positives = 26/53 (49%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +   L+V  +      + L   F  +G++    V+ + ++  ++G+GF+ F D
Sbjct: 415 DMSNLYVCNMPSSIDTKKLVELFLPFGKITHARVVADPDTFSAKGYGFIKFTD 467


>03_01_0293 - 2258647-2258754,2258861-2259085
          Length = 110

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQ 265
           K+FVGG+   T  E+L+R+F  +G V    +  +  +GR  GF F+ F     L+N +  
Sbjct: 8   KMFVGGIGPYTGDEDLRRHFQLFGYVASVHMPIDRHTGRHHGFAFIQFTCLEHLINALAY 67

Query: 266 NGPHQLDGRTIDPKPCNPR 322
              H + G T+  +   PR
Sbjct: 68  R--HTIHGHTLGTRLIEPR 84


>01_04_0003 -
           14989160-14989445,14989673-14989807,14991418-14991508,
           14991571-14991712,14991924-14992403,14992610-14993548
          Length = 690

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 18/42 (42%), Positives = 30/42 (71%)
 Frame = +2

Query: 104 GLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           G S+ T++ +L++ FS+YG V    V+++  SG SRGFGF++
Sbjct: 521 GFSYATTERDLEKKFSKYGRVTSARVVRDKRSGDSRGFGFLS 562



 Score = 29.1 bits (62), Expect = 2.7
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F +YG+V    ++ D+    S G GFLS E +
Sbjct: 535 FSKYGRVTSARVVRDKRSGDSRGFGFLSLEKD 566


>09_04_0506 - 18188785-18190599
          Length = 604

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 2/83 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ-- 265
           LFVG L W T+  +L+   S+YG+V +        SG+S+G+  V F DP       +  
Sbjct: 187 LFVGELHWWTTDADLEAELSKYGQVKEVRFFDEKASGKSKGYCQVDFYDPGAAASCKEGM 246

Query: 266 NGPHQLDGRTIDPKPCNPRTLQK 334
           NG H  +GR       +P T+++
Sbjct: 247 NG-HLFNGRPCVVAFASPHTVRR 268


>04_04_0435 -
           25170348-25170593,25170989-25171189,25171580-25171756,
           25172284-25172418,25173131-25173262,25173292-25173369,
           25173452-25174108,25174210-25174328,25175897-25176173
          Length = 673

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 25/80 (31%), Positives = 43/80 (53%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           +D  +   +FV  LS  T++E+L + F  YG +   V+M   + G+SR FGF+ F  P  
Sbjct: 212 VDKTKFNNVFVKNLSESTTKEDLVKIFGAYGNITSAVIMVGMD-GKSRCFGFINFKSPDD 270

Query: 248 VNLVLQNGPHQLDGRTIDPK 307
               ++    +L+G+ I+ K
Sbjct: 271 AARAVE----ELNGKKINDK 286



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 6/126 (4%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P         +F+  L      + L   FS +G ++ C V  + E G+S+GFGFV +  
Sbjct: 118 DPSSRRSGSANIFIKNLDKAIDHKTLHDTFSAFGNILSCKVATD-EMGQSKGFGFVQYDK 176

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRT-LQKPKRGGGYPK-----VFLGGLPSNVTET 400
                   Q+    L+G  I+ KP      L+K +R     K     VF+  L  + T+ 
Sbjct: 177 GE----AAQSAIKSLNGMLINDKPVYVGPFLRKQERENSVDKTKFNNVFVKNLSESTTKE 232

Query: 401 DLRXIF 418
           DL  IF
Sbjct: 233 DLVKIF 238



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L+VG L    +   L   FS+ G+V+   V ++  S RS G+ +V F +P
Sbjct: 41  LYVGDLEASVTDSQLYELFSQAGQVMSVRVCRDISSRRSLGYAYVNFNNP 90


>01_07_0362 +
           43063345-43063420,43064176-43064244,43064348-43064454,
           43064561-43064608
          Length = 99

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 1/65 (1%)
 Frame = +2

Query: 107 LSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN-GPHQL 283
           LS++T++  L+  FS++G +I   V+ +  +G+S+G+GFV FA        L   G   +
Sbjct: 27  LSYDTNETALKDAFSQHGHIIQVKVICHPVTGKSKGYGFVKFASEDEAAAALHKMGGEVI 86

Query: 284 DGRTI 298
           DGR I
Sbjct: 87  DGRNI 91


>08_02_0651 -
           19714348-19714395,19715319-19715429,19715503-19715572,
           19716081-19716178,19716272-19716319,19716391-19716446,
           19718191-19718314,19718417-19718506
          Length = 214

 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 22/101 (21%), Positives = 50/101 (49%), Gaps = 6/101 (5%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P+  ++    L++G +     +E +Q +F ++G V    + +N ++G+S+ +GF+ F +P
Sbjct: 46  PEEPENTSTVLYIGHIPHGFYEEQMQGFFQQFGTVKRLRIARNRKTGKSKHYGFIEFENP 105

Query: 242 SLVNLVLQN------GPHQLDGRTIDPKPCNPRTLQKPKRG 346
            +  +V           H L    + P+  +P+  +  +RG
Sbjct: 106 EVAKIVADEMNNYLLFEHTLQIAIVPPEKIHPKLWKGVRRG 146


>03_03_0192 -
           15308602-15308869,15309457-15309528,15310271-15310337,
           15310449-15310528,15310636-15310714,15310815-15310890
          Length = 213

 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 25/70 (35%), Positives = 38/70 (54%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V  +S+ T+ ++L   F R GEV+D  + ++  +G SRGF FV +          Q  
Sbjct: 18  LLVLNVSFRTTADDLLALFDRCGEVLDIRIPRDRRTGDSRGFAFVRYKYED----EAQKA 73

Query: 272 PHQLDGRTID 301
             +LDGRT+D
Sbjct: 74  VDKLDGRTVD 83


>08_02_1098 - 24291138-24291851,24292607-24292861
          Length = 322

 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 41/130 (31%), Positives = 58/130 (44%), Gaps = 23/130 (17%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG-----FGFVTFADPSLV 250
           G++FV GL+  T + +L R+F RYG V+D V +   E+    G     F  V F  P   
Sbjct: 12  GRVFVRGLAAGTGEADLLRHFDRYG-VVDEVSIPGVEADTLTGLPALRFAIVKFGHPEFA 70

Query: 251 NLVLQNGPHQLDGRTI-----DP----------KPCNPRTLQ---KPKRGGGYPKVFLGG 376
            L L +    +DG+T+     DP          KP    T Q   + +R G   KV +G 
Sbjct: 71  GLALADREQVIDGQTVHVGREDPRQSGCHSSGYKPLKQSTRQIGERKRRVGDMIKVVIGP 130

Query: 377 LPSNVTETDL 406
           LP +  E  L
Sbjct: 131 LPEDSLERGL 140


>11_06_0326 - 22382001-22383248
          Length = 415

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 32/122 (26%), Positives = 49/122 (40%), Gaps = 3/122 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +LFV GL        L   FSR+G + +C V+    +G  +GFGFVTF   +     L+ 
Sbjct: 89  RLFVHGLPPHADAPALAAAFSRFGPLAECDVVARRATGACKGFGFVTFQSRAAARRALRE 148

Query: 266 --NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
              G   + GR +  +             G   +V++  +    +   LR  F    E  
Sbjct: 149 VGRGGVAVAGRAVSAQYATAGAAAAASAAG--RRVYVTNVAPGASAERLRAFFAGFGELE 206

Query: 440 GG 445
           GG
Sbjct: 207 GG 208


>02_01_0251 -
           1652356-1652522,1652564-1652608,1652658-1652733,
           1652976-1653041,1653120-1653238,1653334-1653508,
           1653604-1653881,1654253-1654436,1654455-1654550,
           1654872-1655012,1655091-1655123
          Length = 459

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 27/98 (27%), Positives = 48/98 (48%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           DD+E   ++VG +    S+ +L+  F ++G +I   V   S       + FV F + S V
Sbjct: 300 DDEESKSVYVGNVPSSVSEADLENEFKKFGRLIPDGVAIRSRKETGGYYAFVEFEELSGV 359

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKV 364
           +  L+  P +++GR I  +   P +     RGG Y ++
Sbjct: 360 HNALKASPIEINGRQIYVEERKPNS---GIRGGNYTQL 394


>02_04_0518 + 23601355-23602498,23603481-23603779
          Length = 480

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 33/121 (27%), Positives = 51/121 (42%), Gaps = 2/121 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +LFV GLS   +   +   F+ +G + +C  + +  +GR RG+GFVTF   S     L  
Sbjct: 105 RLFVHGLSPGVTAAAMAAAFAPFGALDECHAVADRATGRCRGYGFVTFRRRSAARRALAA 164

Query: 269 GPHQLDGRTIDPKPCNPRTL--QKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGHG 442
                      P  C   +L    P R     K+F+  +P+     +LR +F    E   
Sbjct: 165 DASSRLAVGGRPVACQLASLGPTSPDR-----KLFVDNVPARAAHDELRRLFSRFGEIEA 219

Query: 443 G 445
           G
Sbjct: 220 G 220



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 18/67 (26%), Positives = 32/67 (47%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFV  +    + + L+R FSR+GE+    +  +  +G+ RG+    +  P  +   L+ 
Sbjct: 192 KLFVDNVPARAAHDELRRLFSRFGEIEAGPLGADRATGQFRGYAIFFYKYPEGLTKALEE 251

Query: 269 GPHQLDG 289
                DG
Sbjct: 252 RKVVFDG 258


>08_01_0098 -
           700443-700660,701112-701268,701586-701678,701763-702149,
           702755-702829,703486-703609,703693-703832,703904-703993,
           704254-704298,704917-705042,705138-705272,705966-706451,
           706539-706596,706728-706855,707209-707463
          Length = 838

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 19/94 (20%), Positives = 47/94 (50%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           +K   ++  +    ++E+++R+FS  G V    ++++  + +SRG  +V F+D   +   
Sbjct: 671 DKCTAYMSNIDLTANEEHIRRFFSDIGGVTAIRLLRDKFTKKSRGIAYVDFSDNEHLEAA 730

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK 361
           ++   H+L  + +     +P   +K +  G + K
Sbjct: 731 IRKNKHKLLAKKVSVARSDPSKGKKNREAGSFSK 764


>02_05_0627 +
           30463452-30463774,30463841-30463956,30464125-30464371,
           30464458-30464555,30465216-30465284,30465752-30465820,
           30465913-30466028
          Length = 345

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 17/48 (35%), Positives = 33/48 (68%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +LFV GLS+ TS++ L+  F  +GE+++  ++ +  S RS+G+ F+ +
Sbjct: 280 RLFVTGLSFYTSEKTLRAAFEPFGELVEVKIIMDKISKRSKGYAFIEY 327


>07_03_1316 +
           25736931-25737206,25737276-25737329,25738036-25738189,
           25740235-25740313,25740413-25740492,25740588-25740654,
           25741548-25741619,25742071-25742223,25742309-25742392,
           25742811-25742877
          Length = 361

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +2

Query: 119 TSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTI 298
           T+ ++L   F +YGEV+D  + ++  +G SRGF FV +          Q    +LDGR +
Sbjct: 163 TTADDLSPLFEKYGEVVDIYIPRDRRTGDSRGFAFVRYKYED----EAQKAVDRLDGRVV 218

Query: 299 D 301
           D
Sbjct: 219 D 219


>11_06_0418 -
           23317077-23317343,23317614-23317787,23317886-23317971,
           23318125-23318244,23318338-23318368,23318457-23318532,
           23318672-23318759,23318877-23318938,23319041-23319117,
           23319890-23319992,23320237-23320298,23321116-23321289,
           23322160-23322405
          Length = 521

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 24/67 (35%), Positives = 38/67 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +FVG L  E +   L  +F+ +    D  VM + ++GRSRGFGFV+F +        QN 
Sbjct: 246 IFVGDLCPEVTDAALFAFFAGFTSCSDARVMWDQKTGRSRGFGFVSFRNQQ----DAQNA 301

Query: 272 PHQLDGR 292
            ++L+G+
Sbjct: 302 INELNGK 308



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 25/87 (28%), Positives = 38/87 (43%), Gaps = 5/87 (5%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG L  + +  ++ R+F   G       ++     R +GFGFV ++      L +Q G
Sbjct: 367 VYVGNLPHDVNSNDVHRFFHSLG----VGSIEEVRVTRDKGFGFVRYSTHEEAALAIQTG 422

Query: 272 PHQL-DGRTI----DPKPCNPRTLQKP 337
             QL  GR I      KP  P T   P
Sbjct: 423 NGQLIGGRQIKCSWGSKPTPPGTASAP 449



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF  +    +  +M+DQ   +S G GF+SF ++
Sbjct: 263 FFAGFTSCSDARVMWDQKTGRSRGFGFVSFRNQ 295


>08_02_1084 - 24232968-24234779
          Length = 603

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           LFVG L W T+  +L+    +YG V +        SG+S+G+  V F DP++     +  
Sbjct: 185 LFVGELHWWTTDADLEAELIKYGPVKEVRFFDEKASGKSKGYCQVDFYDPAVATACKE-- 242

Query: 272 PHQLDGRTIDPKPC 313
              ++G   + +PC
Sbjct: 243 --AMNGHLFNGRPC 254


>03_05_0235 - 22214700-22214914,22218782-22219045,22219258-22219294
          Length = 171

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           +K  L+VGGL+ E  ++ L   F  +GE+ D     +  + + R FGFVTF +       
Sbjct: 6   QKNTLYVGGLAEEVDEKILHAAFVPFGEIKDVKTPLDQATQKHRSFGFVTFLEREDAAAA 65

Query: 260 LQN-GPHQLDGRTIDPKPCNPRTLQKPKRG 346
           + N    +L GR +      P  ++  ++G
Sbjct: 66  MDNMDGAELFGRVLTVNYAFPERIKGGEQG 95


>09_01_0112 +
           1737438-1737777,1738441-1738511,1738974-1739052,
           1741559-1741641,1741733-1741784,1742038-1742105,
           1742279-1742345,1742426-1742505,1742576-1742640,
           1742785-1742847,1743271-1743427,1743511-1743588,
           1743677-1744219,1744321-1744497,1744534-1744788,
           1745270-1745329,1745874-1745888,1746123-1746135,
           1746819-1746934
          Length = 793

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 2/69 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVL 262
           KLFV  L+ + + + ++  F+ YG V D  +MK+    +SRG GFV F+  +P+L  +  
Sbjct: 214 KLFVASLNKQATAKEIEEIFAPYGHVEDVYIMKDG-MRQSRGCGFVKFSSREPALAAMSA 272

Query: 263 QNGPHQLDG 289
            +G + + G
Sbjct: 273 LSGNYVMRG 281



 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 23/112 (20%), Positives = 54/112 (48%), Gaps = 2/112 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLF+G +    ++++++  F  +G+V++  ++K+ ++G  +G  FV +A        ++ 
Sbjct: 123 KLFIGSVPRTATEDDVRPLFEEHGDVVEVALIKDRKTGEQQGCCFVKYATSEEAERAIRA 182

Query: 266 -NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            +  + L G  + P        ++ + G    K+F+  L    T  ++  IF
Sbjct: 183 LHNQYTLPG-AMGPIQVRYADGERERHGAIEHKLFVASLNKQATAKEIEEIF 233



 Score = 28.3 bits (60), Expect = 4.8
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 353 YPKVFLGGLPSNVTETDLRXIF 418
           Y K+F+G +P   TE D+R +F
Sbjct: 121 YVKLFIGSVPRTATEDDVRPLF 142


>02_02_0008 +
           6061508-6061624,6062468-6062566,6062636-6063039,
           6064218-6064278,6064413-6064466,6064786-6064854,
           6064993-6065058,6065162-6065230,6065448-6065537
          Length = 342

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 18/52 (34%), Positives = 34/52 (65%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +E+  ++VGGL +E +++ L+  F R+G ++   V+ N +  R + +GFVTF
Sbjct: 6   NEETSVYVGGLPYEANEDMLRDAFGRFGTIVSVKVI-NDQRVRGKCYGFVTF 56


>10_08_0254 +
           16236689-16236793,16237760-16237808,16237988-16238076,
           16238178-16238234,16238684-16238746,16238828-16238893,
           16239520-16239606,16239691-16239784,16240351-16240673,
           16241022-16241048,16241065-16241145,16241445-16241476,
           16242126-16242266,16242455-16242516,16243170-16243387
          Length = 497

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVI-DCVVMKNSESGRSRGFGFVTF 232
           D    LF+G L  +  ++ L   FS +G ++ +  +M++ E+G SRGFGFV++
Sbjct: 109 DVGANLFIGNLDPDVDEKLLYDTFSAFGVIVTNPKIMRDPETGNSRGFGFVSY 161



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +VG L  + S+E L   F + G V++  V K+  +   +G+GFV F
Sbjct: 28  YVGNLDPQVSEELLWELFVQAGPVVNVYVPKDRVTNLHQGYGFVEF 73


>09_06_0188 - 21441377-21442201
          Length = 274

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           K  ++V  L +  +  +L   FSR+G V    V+K+ +S RSRG  FV F
Sbjct: 69  KSTVYVSNLDFALTNSDLHTLFSRFGRVARVTVLKDRDSRRSRGVAFVLF 118


>08_02_1039 -
           23866743-23866862,23866985-23867266,23867868-23867966,
           23868595-23868903
          Length = 269

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 3/113 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVNLVLQ 265
           +L    + W+ + ++++  F ++G V+D V +    S R+RG  FVT  ++   ++ +  
Sbjct: 74  RLIAQNIPWDCTADDMRALFGKHGSVVD-VELSMYNSTRNRGLAFVTMGSEEEALSALNH 132

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK--VFLGGLPSNVTETDLRXIF 418
                L+ RTI       R  Q        PK  VF+G L   V    LR +F
Sbjct: 133 LNSTTLNDRTIKVDFTRSRKKQYVVPSAPMPKHSVFVGNLTWRVRSRHLRELF 185



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 3/76 (3%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDC-VVMKNSESGRSRGFGFVTFADPSLVNLV 259
           K  +FVG L+W     +L+  F+    V    VV   +   RS G+GFV+F+        
Sbjct: 164 KHSVFVGNLTWRVRSRHLRELFASTPGVQSVEVVFHTTSPRRSAGYGFVSFSSKEAAEAA 223

Query: 260 LQ--NGPHQLDGRTID 301
           +   NG  +L GR+I+
Sbjct: 224 ISTFNGT-KLMGRSIN 238


>06_03_1455 +
           30264023-30264174,30265930-30266070,30266328-30266430,
           30266510-30266659,30267184-30267229,30267383-30267738
          Length = 315

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 20/46 (43%), Positives = 27/46 (58%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           L+V GLS   ++  L+ YFS+ G V  C V+    +  SRGF FVT
Sbjct: 109 LYVTGLSSRVTERELKDYFSKEGRVTSCHVVLEPHTRVSRGFAFVT 154


>12_02_0846 -
           23623624-23623784,23624076-23624258,23624601-23624641,
           23624746-23624910,23625808-23625885,23626024-23626169
          Length = 257

 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 21/52 (40%), Positives = 27/52 (51%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           G L V  +      E+L+  F R+G V D  + K+  SG  RGF FV F DP
Sbjct: 37  GSLLVRNIPLSCRGEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDP 88


>07_03_1389 +
           26212117-26212119,26212721-26212875,26213402-26213479,
           26214211-26214375,26214453-26214554,26214661-26214786,
           26215454-26215490
          Length = 221

 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L V  L  +   E+L+R F ++G + D  + ++  SG  RGFGFV + DP
Sbjct: 43  LLVRNLRRDCRPEDLRRPFGQFGRLKDIYIPRDYYSGEPRGFGFVQYYDP 92


>05_01_0148 -
           985745-986180,986290-986385,986498-986694,986824-986919,
           987020-987059,987751-987857
          Length = 323

 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 2/105 (1%)
 Frame = +2

Query: 74  DDEKG--KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           DD  G  +L+VG LS  T   +L+ +FSRYG + + V +K       R + F+ F+DP  
Sbjct: 5   DDRYGSTRLYVGRLSSRTRSRDLEYHFSRYGRIRE-VELK-------RDYAFIEFSDPR- 55

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLP 382
                +   + LDGR +D         +   RG G  + ++G  P
Sbjct: 56  ---DAEEARYNLDGRDVDGSRILVEFAKGVPRGPGGSREYMGRGP 97


>04_04_0674 +
           27173948-27174188,27174704-27175260,27175310-27175399,
           27175475-27175714,27175801-27176022,27176124-27176433,
           27176528-27176847,27176906-27177021,27177133-27177227,
           27177331-27177407,27177520-27177615
          Length = 787

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 15/49 (30%), Positives = 32/49 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           ++FVGGL  + ++ +L++ F   GE+ +  +M N  + +++GF F+ +A
Sbjct: 191 EVFVGGLDKDATESDLRKVFGEVGEITEVRLMMNPVTKKNKGFAFLRYA 239



 Score = 38.3 bits (85), Expect = 0.004
 Identities = 16/60 (26%), Positives = 34/60 (56%), Gaps = 3/60 (5%)
 Frame = +2

Query: 62  PDMDDDEKGKL---FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P++DD+   ++   F+ GL     ++ +++Y  +YG +    + +N  + + + FGFVTF
Sbjct: 367 PEVDDEIMAQVRTVFIDGLPPSWDEDRVKKYLKKYGAIEKVELARNMPAAKRKDFGFVTF 426



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIFRTLWE 433
           +VF+GGL  + TE+DLR +F  + E
Sbjct: 191 EVFVGGLDKDATESDLRKVFGEVGE 215


>03_03_0117 -
           14583102-14583186,14585202-14585336,14585440-14585604,
           14586168-14586245,14586796-14586941
          Length = 202

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           D D    L V  L  +   ++L+R F ++G V D  + ++  +G  RGFGF+ + DP
Sbjct: 32  DRDLPTSLLVRNLRRDCRPDDLRRPFGKFGRVKDIYLPRDYYTGEPRGFGFIQYYDP 88


>02_02_0387 - 9606744-9607475
          Length = 243

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +++ G LS +  +  L+  +S +G+V+   V+ +   GRSRGFGFVT A
Sbjct: 139 RIYAGDLSPQVDRLRLREMYSEHGKVVQARVVYDKR-GRSRGFGFVTMA 186


>02_02_0284 -
           8547126-8547187,8547306-8547395,8547810-8547861,
           8548209-8548284,8550513-8550632,8553334-8553423,
           8553842-8554024,8554125-8554185,8554437-8554477,
           8554563-8554727,8555699-8555776,8556137-8556282
          Length = 387

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 20/52 (38%), Positives = 27/52 (51%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           G L V  +      E+L+  F R+G V D  + K+  +G  RGF FV F DP
Sbjct: 37  GSLLVRNIPLSCRAEDLRVPFERFGPVRDVYLPKDYYTGEPRGFAFVEFVDP 88


>02_02_0238 +
           8163922-8164362,8165008-8165118,8165205-8165249,
           8166066-8166138,8166215-8166327,8166430-8166489,
           8167287-8167334,8167422-8167490,8167618-8167679,
           8167771-8167828
          Length = 359

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 33/136 (24%), Positives = 58/136 (42%), Gaps = 9/136 (6%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G     D +D  +  ++V  +  + +++ L   FS  G+V+DC +  +  S     F F+
Sbjct: 161 GRTRRADREDSVRRTVYVSDIDQQVTEQKLAEVFSNCGQVVDCRICGDPHS--VLRFAFI 218

Query: 227 TFADPSLVNLVLQNGPHQL---DGRTIDPK----PCNPRTLQK--PKRGGGYPKVFLGGL 379
            FAD +     L  G   L     R +  K    P NP+ L +   ++      V+   +
Sbjct: 219 EFADDAGARAALTLGGTMLGYYPVRVLPSKTAILPVNPKFLPRTEDEKEMVSRTVYCTNI 278

Query: 380 PSNVTETDLRXIFRTL 427
              VTE D++  F+ L
Sbjct: 279 DKKVTEEDVKIFFQQL 294


>05_04_0092 +
           17851085-17851346,17852778-17852860,17853891-17853942,
           17854054-17854179,17854291-17854373,17855127-17855309,
           17855731-17855947,17856156-17856299,17856375-17856446,
           17857166-17857230,17857517-17857584,17857968-17858007,
           17858843-17859013
          Length = 521

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           KLF+G L    +   +   FS+YG + D  +++ S+     G  F+ +   + +L  +  
Sbjct: 135 KLFIGMLPKNVTDAEMTDLFSQYGNIKDLQILRGSQQTSKAGCAFLKYETKEQALAAIEA 194

Query: 263 QNGPHQLDGRTI 298
            NG H+++G ++
Sbjct: 195 LNGKHKIEGSSV 206



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 4/118 (3%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E  KLFVG +  + +++ L   F+    V +  ++++  +  SRG  F+        + 
Sbjct: 43  EESVKLFVGQVPKQMTEDELAAMFAAVAVVDEVTLIRDKATKASRGCCFLICPSREEADK 102

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP----KVFLGGLPSNVTETDLRXIF 418
            + N  H  + RT+ P   +P  LQ     G       K+F+G LP NVT+ ++  +F
Sbjct: 103 AV-NAYH--NKRTL-PGASSP--LQVKYADGELERLEHKLFIGMLPKNVTDAEMTDLF 154


>04_04_1223 +
           31851545-31852609,31854314-31854773,31856201-31856250,
           31856333-31856463,31856569-31856665,31856759-31856950,
           31857121-31857123
          Length = 665

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 37/130 (28%), Positives = 57/130 (43%), Gaps = 14/130 (10%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFADPS- 244
           DD     +FVG L+ + +   LQ  F   Y  V    V+ +  + RS+G+GFV F DP+ 
Sbjct: 415 DDTPDYTIFVGDLAADVTDYLLQETFRVHYPSVKGAKVVTDKMTMRSKGYGFVKFGDPTE 474

Query: 245 LVNLVLQNGPHQLDGRTIDPKP-CNPRTL----QKPKRGGGYPK-------VFLGGLPSN 388
               + +        R +   P  N +T     + P   G   +       +F+GGL  N
Sbjct: 475 QARAMTEMNGMLCSSRPMRIGPAANKKTTGVQERVPNAQGAQSENDPNNTTIFVGGLDPN 534

Query: 389 VTETDLRXIF 418
           VTE  L+ +F
Sbjct: 535 VTEDVLKQVF 544



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 21/93 (22%), Positives = 43/93 (46%)
 Frame = +2

Query: 179 VMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
           ++++ +SG+ +G+GFV F   +  + +LQ    Q+          N  +  + +      
Sbjct: 361 LIRDKQSGQLQGYGFVEFTSRAAADRILQTYNGQMMPNVEMVFRLNWASAGEKRDDTPDY 420

Query: 359 KVFLGGLPSNVTETDLRXIFRTLWEGHGGGHYV 457
            +F+G L ++VT+  L+  FR  +    G   V
Sbjct: 421 TIFVGDLAADVTDYLLQETFRVHYPSVKGAKVV 453



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVI 169
           +D     +FVGGL    +++ L++ F+ YGEV+
Sbjct: 519 NDPNNTTIFVGGLDPNVTEDVLKQVFAPYGEVV 551


>02_04_0661 -
           24802868-24802921,24803004-24803089,24803178-24803274,
           24803378-24803475,24804705-24804882,24805485-24805676
          Length = 234

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 22/78 (28%), Positives = 44/78 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +LF G L  E + + L + FS+Y       V+++  +G++RG+ FV+FA+ S +   L+ 
Sbjct: 127 RLFCGDLGNEVNDDVLTKAFSKYPSFNMARVIRDKWTGKTRGYAFVSFANASDLAAALK- 185

Query: 269 GPHQLDGRTIDPKPCNPR 322
              +++G+ +  +P   R
Sbjct: 186 ---EMNGKYVGNRPIKLR 200


>01_07_0120 +
           41185884-41186127,41187228-41187310,41188596-41188647,
           41188729-41188854,41188967-41189049,41189308-41189490,
           41189901-41190237,41190607-41190750,41190854-41190939,
           41191069-41191113
          Length = 460

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           KLF+G L    +   L   FS+YG + D  +++ S+     G  F+ +   + ++  +  
Sbjct: 129 KLFIGMLPKNVTDTELTDLFSKYGNIKDLQILRGSQQTSKAGCAFLKYETKEQAVAAIEA 188

Query: 263 QNGPHQLDGRTI 298
            NG H+++G ++
Sbjct: 189 LNGKHKIEGSSV 200



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 15/51 (29%), Positives = 28/51 (54%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           LF+  +  +   ++L   F R+G V+   V  +  +G S+ FGFV++  P+
Sbjct: 376 LFIYHIPQDYGDQDLSNAFQRFGRVLSAKVFVDKATGSSKCFGFVSYDSPA 426



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 2/117 (1%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           ++E  KLFVG +    ++  L   F     V +  V+K+  +  SRG  F+        +
Sbjct: 36  EEESVKLFVGQVPKHMTEAELLAMFQEVAIVDEVTVIKDKATKASRGCCFLICPSREEAD 95

Query: 254 LVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +   +  H L G +    P   +          + K+F+G LP NVT+T+L  +F
Sbjct: 96  KAVNAYHNKHTLPGAS---SPLQVKYADGELERLEH-KLFIGMLPKNVTDTELTDLF 148


>03_02_0874 +
           12017069-12018051,12018137-12018316,12018421-12018600,
           12018718-12018797,12018999-12019259,12019360-12019474,
           12019631-12019855,12020840-12020849
          Length = 677

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 35/97 (36%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = +2

Query: 125 QENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG-PHQLDGRTID 301
           +E++  YFS YG V D  +    +    R FGFVTF  P  V L+L  G PH +      
Sbjct: 380 EEDVSNYFSIYGPVHDVRIPYQQK----RMFGFVTFVYPETVKLILAKGNPHFI------ 429

Query: 302 PKPCNPRTLQKP-KRGGGYP-KVFLGGLPSNVTETDL 406
              C+ R L KP K  G  P K   G      T T L
Sbjct: 430 ---CDARVLVKPYKEKGKVPDKKHQGDFSGCTTPTGL 463


>03_01_0525 +
           3952095-3952217,3953131-3953614,3953695-3953750,
           3953942-3954018,3954862-3954958,3955274-3955407,
           3955760-3955825,3955954-3956044
          Length = 375

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 32/131 (24%), Positives = 57/131 (43%), Gaps = 4/131 (3%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E   L++G L +   +  L   F+  GE+    +++N  +    G+GF+ F    +   
Sbjct: 13  EEVRTLWIGDLQYWADENYLYNCFAHTGELQSVKIIRNKLTSLPEGYGFIEFISHEVAEK 72

Query: 257 VLQ--NGPHQLDG--RTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
           VLQ  NG  Q+ G   T      +  + ++    G    +F+G L  +VT+  L+  FR 
Sbjct: 73  VLQTYNGT-QMPGTEHTFRLNWASFSSGERRPDAGPDHSIFVGDLAPDVTDYLLQETFRV 131

Query: 425 LWEGHGGGHYV 457
            +    G   V
Sbjct: 132 SYPSVKGAKVV 142



 Score = 38.3 bits (85), Expect = 0.004
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           PD   D    +FVG L+ + +   LQ  F   Y  V    V+ +  +GRS+G+GFV FAD
Sbjct: 103 PDAGPDHS--IFVGDLAPDVTDYLLQETFRVSYPSVKGAKVVTDPNTGRSKGYGFVKFAD 160

Query: 239 PSLVN 253
            +  N
Sbjct: 161 ENEKN 165


>05_01_0455 -
           3614011-3614503,3615007-3615072,3615154-3615347,
           3615562-3615657,3615790-3615829,3616729-3616856
          Length = 338

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 28/71 (39%), Positives = 37/71 (52%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +L+VG +S  T  E+L+  FSRYG V   V +KN        +GFV F+DP   N    +
Sbjct: 19  RLYVGHISLRTRAEDLENLFSRYGRV-RFVDLKNE-------YGFVEFSDPRDAN----D 66

Query: 269 GPHQLDGRTID 301
               LDGR  D
Sbjct: 67  ARLDLDGRKYD 77


>02_05_1014 + 33510108-33510471,33510857-33511362
          Length = 289

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/52 (32%), Positives = 31/52 (59%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++  + V  LS +T +E+L+  F  +G +    V  +  +G SRGFGF++F
Sbjct: 205 NDENSVRVTNLSEDTREEDLRELFGSFGPLTRAYVALDHRTGESRGFGFLSF 256


>11_08_0081 -
           28216179-28216381,28216590-28216657,28217131-28217298,
           28217370-28217436,28217509-28217576,28218256-28218420,
           28218490-28218556,28218629-28218696,28219855-28219992,
           28220189-28220353,28221227-28221304,28221380-28221532,
           28222753-28222823,28223077-28223203,28223306-28223565,
           28223679-28223842,28224287-28224450,28225873-28226159
          Length = 826

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           LFV  L      E++Q  F ++G V D  + K+  +G  RGF FV FA  S
Sbjct: 399 LFVSNLPRSCRPEDVQVPFQKFGPVRDVYLPKDYNTGEPRGFAFVEFAHSS 449


>08_01_0600 -
           5262573-5262773,5262850-5262952,5263050-5263180,
           5263263-5263312,5265266-5265725,5266349-5266708
          Length = 434

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 1/59 (1%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           DD     +FVG L+ + +   LQ  F   Y  V    V+ +  + RS+G+GFV F DPS
Sbjct: 180 DDTPDYTIFVGDLAADVTDYILQETFRVHYPSVKGAKVVTDKMTMRSKGYGFVKFGDPS 238



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 26/127 (20%), Positives = 56/127 (44%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E   L++G L +   +  +   F+  GE+    ++++ ++G+ +G+GF+ F   +    
Sbjct: 92  NEVRTLWIGDLQYWMDENYISACFAPTGELQSVKLIRDKQTGQLQGYGFIEFTSHAGAER 151

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEG 436
           VLQ     +          N  +  + +       +F+G L ++VT+  L+  FR  +  
Sbjct: 152 VLQTYNGAMMPNVEQTYRLNWASAGEKRDDTPDYTIFVGDLAADVTDYILQETFRVHYPS 211

Query: 437 HGGGHYV 457
             G   V
Sbjct: 212 VKGAKVV 218



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 18/61 (29%), Positives = 29/61 (47%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D     +FVGGL    + + L++ F+ YG+V+   +      G  + F     AD +LV 
Sbjct: 285 DPSNTTIFVGGLDPSVTDDMLKQVFTPYGDVVHVKIPVGKRCGFVQ-FANRASADEALVL 343

Query: 254 L 256
           L
Sbjct: 344 L 344


>07_03_1709 -
           28873172-28873327,28873519-28873584,28874067-28874127,
           28875406-28875462,28876301-28876531,28876685-28876799,
           28876897-28877136,28877222-28877316,28877406-28877585,
           28877663-28877839,28877920-28878890
          Length = 782

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +2

Query: 125 QENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG-PHQLDGRTID 301
           +E++  YFS YG V D  +    +    R FGFVTF  P  V L+L  G PH +    + 
Sbjct: 375 EEDVSNYFSIYGPVHDVRIPYQQK----RMFGFVTFVYPETVKLILAKGNPHFICDARVL 430

Query: 302 PKP 310
            KP
Sbjct: 431 VKP 433


>07_01_0280 + 2064865-2065080,2065442-2065531,2065690-2065893
          Length = 169

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 26/90 (28%), Positives = 43/90 (47%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           MR +P++      +LFVG ++  T +  L+R+F  YG+V D  +         R F FV 
Sbjct: 1   MRTSPEIS----ARLFVGRVAPGTGKAELRRHFKVYGDVADIWLR------HDRPFAFVQ 50

Query: 230 FADPSLVNLVLQNGPHQLDGRTIDPKPCNP 319
           F  P+     L +  H ++GR +  +   P
Sbjct: 51  FIQPAHAARALADKDHFINGRKVYIRVAQP 80


>05_01_0041 +
           281427-281549,281671-281730,281822-281868,282013-282089,
           285368-285440,286193-286281,286665-286711,286805-286885,
           287011-287179,287381-287600,287679-287744,288194-288310,
           288591-288628,288935-289032
          Length = 434

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF---ADPSLV 250
           E   L V  LS   ++++L+  F  YGEV++  +  +      RG+G+V F   AD    
Sbjct: 134 ESTVLHVDHLSRNVNEDHLKEIFENYGEVVNVELSMDRVVNLPRGYGYVEFKNRADAEKA 193

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQK 334
            L L  G  Q+DG  +  +   P   Q+
Sbjct: 194 LLYLDGG--QIDGNVVKVRFALPPQQQR 219


>04_04_1121 -
           31041629-31041793,31041891-31042022,31042255-31042425,
           31042521-31042622,31042703-31042807,31043115-31043286,
           31043916-31043980,31044179-31044502,31044729-31044846,
           31044928-31045011,31045472-31045603,31045714-31046570,
           31046735-31046849,31047371-31047481,31047763-31047824
          Length = 904

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 23/85 (27%), Positives = 39/85 (45%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E G+LF   L + T++ +L    S+YG+V    ++ +  +  S G G+V F+ P      
Sbjct: 368 ETGRLFFCNLPYATTEGDLVELCSQYGDVDQARIVVDKTTKLSTGRGYVLFSLPDSAVRA 427

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQK 334
           L+       GR +  K   P   +K
Sbjct: 428 LELDNSSFQGRLLRVKAAKPLNNKK 452



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 19/48 (39%), Positives = 27/48 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +L V  L     +  L+  FSR GEV D  V++ ++ G+SR F FV F
Sbjct: 24  RLCVKNLPKGADEGRLREVFSRKGEVTDAKVIR-TKDGKSRQFAFVGF 70


>11_01_0142 -
           1169007-1169032,1169351-1169538,1169978-1170131,
           1170565-1170656,1170782-1170961,1171080-1171244,
           1171309-1171709
          Length = 401

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG-PHQLDGRTI 298
           S+E++  YFS YG V D  +    +    R FGFVTFA    V L+L  G PH +    +
Sbjct: 180 SKEDVCNYFSMYGMVQDVRIPYQEK----RMFGFVTFAYQKTVKLILAKGNPHYICDARV 235

Query: 299 DPKP 310
             KP
Sbjct: 236 LVKP 239


>01_06_0834 +
           32302065-32302143,32303136-32303275,32303371-32303436,
           32303867-32303950,32304532-32304699,32305061-32305126,
           32306027-32306452
          Length = 342

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +2

Query: 134 LQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTID 301
           L+ YFS +GEV   +V+ +  +   RGFG + FA        L+   H L G+ ++
Sbjct: 124 LKEYFSNFGEVNRAIVVTDLNTKMPRGFGLIQFASEESTARALKKDRHFLCGQWVE 179


>03_06_0337 +
           33224333-33224479,33224603-33224663,33224740-33224776,
           33225237-33225367,33225447-33225590,33225686-33225776,
           33225973-33226106,33226234-33226373,33227328-33227426,
           33227520-33227602,33227690-33227744,33227826-33227937,
           33228274-33228766,33228881-33229094,33229203-33229273,
           33229733-33229901,33229991-33230120,33230556-33230968,
           33231059-33231262
          Length = 975

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 19/48 (39%), Positives = 25/48 (52%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +FV  L +     +L+  FS  G V  C ++    S  SRGFGFV FA
Sbjct: 36  VFVSNLPYTFKSSDLEAVFSEVGPVRRCFMVAPKGSETSRGFGFVQFA 83



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           K ++ V  L ++ + + +   FS  G + D  + + S+ G S+GF FV+F
Sbjct: 317 KWRVIVRNLPFKITVKEIMDIFSLAGFIWDVSIPQKSDDGASKGFAFVSF 366


>07_01_0577 -
           4286048-4286186,4286600-4286660,4286957-4287089,
           4287286-4287350,4288346-4288451,4288529-4288750,
           4289619-4289852,4289948-4290037,4290605-4291507
          Length = 650

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 13/48 (27%), Positives = 33/48 (68%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++FVGGL  +  +++++  F++ GE+ +  ++ N  +G+++G+ FV +
Sbjct: 237 EVFVGGLHRDAKEDDVRAVFAKAGEITEVRMIMNPLAGKNKGYCFVRY 284



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGL--SWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +PD  D +   +FV G+  SW+ +Q  L+  F ++G++   V+ ++  S + R F F+ +
Sbjct: 402 DPDEKDMQVKSIFVDGIPTSWDHAQ--LKEIFKKHGKIESVVLSRDMPSAKRRDFAFINY 459


>07_01_0286 + 2086630-2086856,2087052-2087067
          Length = 80

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           E  +L VGG+S +     L+ +F RYG+V D  + ++  +G  R F F     P
Sbjct: 5   ESARLSVGGVSPDMGDTELRDHFGRYGDVADIWLRRDRLTGLPRRFAFAGSCTP 58


>03_03_0042 +
           14009649-14009866,14011342-14011419,14011791-14011955,
           14012071-14012138,14012219-14012258,14013579-14013690,
           14013859-14013942
          Length = 254

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 21/66 (31%), Positives = 32/66 (48%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V  +S     E+++  F ++G V D  + +N  +   RGFGFV F  P    +  Q  
Sbjct: 63  LLVRNISLTARPEDIRIPFEQFGPVKDVYLPRNFHTRELRGFGFVKFRYPEDAAVAKQEL 122

Query: 272 PHQLDG 289
            HQ+ G
Sbjct: 123 NHQVIG 128


>12_02_0849 -
           23640091-23640279,23640537-23640677,23640756-23642203,
           23642300-23642372,23642452-23642572,23642689-23642791,
           23642979-23643052,23643140-23643285,23643368-23643476,
           23643580-23643704,23643989-23644342,23644440-23644503,
           23644581-23645032
          Length = 1132

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYF-SRYGEVIDCVV--MKNSESGRSRGFGFVTF 232
           D   K+FVGGL      E L  +F + +G V + VV  ++  +  +SRGFGFV F
Sbjct: 524 DYTRKIFVGGLPPSVGAEYLTEFFTAEFGPVEEAVVIGIRMGDRVQSRGFGFVKF 578


>03_06_0507 +
           34404843-34404968,34405091-34405151,34405260-34405296,
           34405365-34405386,34405861-34405957,34406037-34406180,
           34407034-34407173,34408205-34408255,34408347-34408429,
           34408515-34408590,34408646-34408760,34409080-34409575,
           34409682-34409895,34410000-34410070,34410527-34410695,
           34410787-34410916,34411330-34411742,34411839-34412039
          Length = 881

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 27/83 (32%), Positives = 37/83 (44%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +FV  L +     +L+  FS  G V  C ++    S  SRGFGFV    P L  L++Q  
Sbjct: 29  VFVSNLPYTFKSADLEAVFSEVGPVRRCFMVAPKGSETSRGFGFVQLI-PQL--LLIQKD 85

Query: 272 PHQLDGRTIDPKPCNPRTLQKPK 340
              + GR I  K    R   K +
Sbjct: 86  GFSVAGRKIRVKLATHRAPLKER 108



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           K ++ V  L ++ + + +   FS  G V D  + + S++G S+GF FV+F
Sbjct: 215 KWRVIVRNLPFKITVKEIMDMFSLAGFVWDVSIPQKSDNGTSKGFAFVSF 264


>02_05_1015 + 33512023-33512359,33513550-33514082
          Length = 289

 Score = 36.3 bits (80), Expect = 0.018
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++  + V  LS +T + +L   F  +G V    V  + ++G SRGFGFV F
Sbjct: 205 NDENSVRVTNLSEDTREPDLLELFRTFGPVSRVYVAVDQKTGASRGFGFVNF 256


>04_03_0282 -
           13874547-13874738,13875047-13875134,13875222-13875328,
           13875487-13875542,13875853-13875882,13877397-13877505,
           13877774-13878318,13879584-13879668,13879753-13879914,
           13880293-13880434,13880524-13880624,13882307-13882489
          Length = 599

 Score = 35.9 bits (79), Expect = 0.024
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G   N D D D +  L V  + +  ++E L  +F + G V+   ++ ++ SG  +G  FV
Sbjct: 453 GPHANLDEDADSRTVL-VTNVHFAATKEALSGHFMKCGTVLKINILTDAISGHPKGAAFV 511

Query: 227 TFADPSLV 250
           TF D   V
Sbjct: 512 TFTDKESV 519


>12_01_0144 -
           1097579-1097604,1097940-1098127,1098567-1098720,
           1098825-1099092,1099310-1099550,1099669-1099833,
           1099898-1100298
          Length = 480

 Score = 35.5 bits (78), Expect = 0.032
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG-PHQLDGRTI 298
           S+E++  YFS YG V D  +    +      FGFVTFA    V L+L  G PH +    +
Sbjct: 180 SKEDVCNYFSMYGMVQDVRIPYQEKCM----FGFVTFAYQKTVKLILAKGNPHYICDARV 235

Query: 299 DPKP 310
             KP
Sbjct: 236 LVKP 239


>11_06_0728 +
           26717018-26717306,26717494-26717598,26717789-26717870,
           26717979-26718055,26719087-26719151,26719261-26719302,
           26719385-26719444,26719583-26720203,26720315-26720450,
           26720667-26720734,26720811-26720948
          Length = 560

 Score = 35.5 bits (78), Expect = 0.032
 Identities = 13/56 (23%), Positives = 33/56 (58%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           ++FVGGL +  ++  ++     +G +    ++K+ E+G S+G+ F  + D ++ ++
Sbjct: 347 RIFVGGLPYYFTEAQVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDI 402


>11_06_0490 -
           24293218-24293373,24293454-24293521,24293845-24293986,
           24294079-24294699,24294791-24294871,24295002-24295072,
           24296106-24296176,24296568-24296675,24296786-24297024,
           24297493-24297657
          Length = 573

 Score = 35.5 bits (78), Expect = 0.032
 Identities = 13/56 (23%), Positives = 33/56 (58%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           ++FVGGL +  ++  ++     +G +    ++K+ E+G S+G+ F  + D ++ ++
Sbjct: 352 RIFVGGLPYYFTEAQVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDI 407


>01_01_0768 -
           5935319-5935417,5935536-5935583,5935721-5935780,
           5935884-5935996,5936082-5936154,5936895-5936939,
           5937020-5937133,5937227-5937253,5937963-5938247
          Length = 287

 Score = 35.5 bits (78), Expect = 0.032
 Identities = 31/130 (23%), Positives = 54/130 (41%), Gaps = 9/130 (6%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D +D  +  ++V  +    ++E L   F+  G+V+DC +  +  S     F F+ FAD  
Sbjct: 125 DREDSIRRTVYVSDIDHTVTEERLADIFANCGQVVDCRICGDPHS--VLRFAFIEFADEE 182

Query: 245 LVNLVLQNGPHQL---DGRTIDPK----PCNPRTLQK--PKRGGGYPKVFLGGLPSNVTE 397
                L  G   L     R +  K    P NP+ L +   ++      V+   +   VT+
Sbjct: 183 GARTALNLGGTMLGFYPVRVLPSKTAILPVNPKFLPRTEDEKEMVIRTVYCTNIDKKVTQ 242

Query: 398 TDLRXIFRTL 427
            D++  F  L
Sbjct: 243 LDVKNFFEEL 252


>12_02_0871 +
           23865343-23866016,23866122-23866170,23866276-23866356,
           23866599-23866718,23866957-23867055,23867135-23867194,
           23867316-23867410,23867483-23867508,23869212-23869285,
           23870194-23870259,23871027-23871099,23871585-23871622,
           23873758-23873871,23876079-23876195,23876288-23876368,
           23876468-23876536,23876631-23876669,23876809-23876973,
           23877380-23877484,23877569-23877637,23877754-23877816,
           23877903-23878021,23878124-23878348,23878409-23878610
          Length = 940

 Score = 34.7 bits (76), Expect = 0.055
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 3/80 (3%)
 Frame = +2

Query: 68  MDDDEKGKL---FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +D+DE  K+   FVG L    ++E L++ F   GEV+   V +  +       GFV FA 
Sbjct: 555 VDEDEMAKVKTAFVGNLPANVTEEYLRKLFEHCGEVVRVAVSRKGQ----YPVGFVHFAS 610

Query: 239 PSLVNLVLQNGPHQLDGRTI 298
                  L N   ++DG T+
Sbjct: 611 ----RTELDNAIKEMDGETV 626



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           NPD    +  ++FVGGL    ++  L+  FS  GE++D  +MK+ ++G S+  G     D
Sbjct: 400 NPDRRV-KGAEVFVGGLPRSVTERALREVFSPCGEIVDLRIMKD-QNGISKLQGKRLAVD 457

Query: 239 PSL 247
            SL
Sbjct: 458 LSL 460



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 326 LQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  P R     +VF+GGLP +VTE  LR +F
Sbjct: 398 IANPDRRVKGAEVFVGGLPRSVTERALREVF 428


>02_01_0598 +
           4440018-4440070,4440627-4440693,4440794-4440926,
           4441075-4441120,4442470-4442521,4442601-4442753,
           4443338-4443457,4443549-4443714,4443822-4443934,
           4444049-4444120,4444992-4445213,4445270-4445317,
           4445639-4445697,4445809-4445887,4445982-4446119,
           4446327-4446551,4446643-4447430,4447548-4447723,
           4447911-4448169,4448646-4448707,4451055-4451212,
           4451618-4451743,4452197-4452260,4452386-4452494,
           4452607-4452760,4453055-4453178,4453257-4453333,
           4453442-4453494,4453673-4453727,4453833-4454021
          Length = 1379

 Score = 34.7 bits (76), Expect = 0.055
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 3/59 (5%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVM---KNSESGRSRGFGFVTF 232
           D  D +   L+VG LS +  +  L R F R+G +    +M      E  R R  GFV F
Sbjct: 191 DDGDPQTTNLYVGNLSPKVDENFLMRTFGRFGPIASVKIMWPRTEEERRRQRNCGFVAF 249


>08_02_1282 -
           25852113-25852406,25852495-25852668,25852849-25852940,
           25853465-25853587,25853691-25853721,25854295-25854434,
           25854871-25854932,25855027-25855103,25855766-25855868,
           25856146-25856207,25857213-25857374
          Length = 439

 Score = 34.3 bits (75), Expect = 0.073
 Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 8/128 (6%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G + NP+ + D    ++VG L  E +++ L R+F   G       ++     + +GFGFV
Sbjct: 262 GSKENPENNPDCT-TVYVGNLGHEVNRDELHRHFYNLG----VGAIEEVRVQQDKGFGFV 316

Query: 227 TFADPSLVNLVLQ--NGPHQLDGRTI----DPKPCNPRTLQKPKRG--GGYPKVFLGGLP 382
            +++     L +Q  NG   + G+ I      KP  P T  KP       Y  V + G+P
Sbjct: 317 RYSNHGEAALAIQMANG-LVVRGKPIKCSWGNKPTPPGTSSKPLPPPLPSYQPVPMAGVP 375

Query: 383 SNVTETDL 406
              +  D+
Sbjct: 376 QGFSAADI 383


>06_03_0374 +
           20026179-20026661,20027170-20027280,20027372-20027416,
           20029610-20029682,20029762-20029874,20030009-20030068,
           20031518-20031565,20031658-20031726,20032928-20033092,
           20033630-20033680,20034774-20034803
          Length = 415

 Score = 34.3 bits (75), Expect = 0.073
 Identities = 17/64 (26%), Positives = 30/64 (46%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G     D +D  +  ++V  +    +++ L   FS  G+V+DC +  +  S     F F+
Sbjct: 175 GRPRRTDREDSVRRTVYVSDIDQHVTEQKLAEVFSNCGQVVDCRICGDPNS--VLRFAFI 232

Query: 227 TFAD 238
            FAD
Sbjct: 233 EFAD 236


>04_01_0107 -
           1107976-1108033,1108411-1108638,1110109-1110422,
           1110568-1110680,1111740-1111845
          Length = 272

 Score = 33.9 bits (74), Expect = 0.097
 Identities = 21/49 (42%), Positives = 26/49 (53%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FVG L ++T    L R F RYG  ID + MK+       GF FV F D
Sbjct: 4   VFVGNLDYDTRHSELDRLFYRYGR-IDRIDMKS-------GFAFVYFED 44


>12_01_0001 + 1777-1935,2002-2109,2492-2560,2652-2836,3040-3055
          Length = 178

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS-LVNLVLQ 265
           KL++  L +  S E+++  FS  G+V     +    SGRS+G   V F+  S  +  V +
Sbjct: 73  KLYISNLDYAVSNEDIKELFSEVGDV-KRYSINYDRSGRSKGTAEVVFSRKSDALAAVKR 131

Query: 266 NGPHQLDGR 292
               QLDG+
Sbjct: 132 YNNVQLDGK 140


>11_01_0489 +
           3776563-3776692,3776995-3777073,3777532-3777840,
           3778828-3778898,3778975-3779213,3779306-3779383,
           3779734-3780156,3780416-3780661,3780886-3780978,
           3781480-3781527
          Length = 571

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 15/68 (22%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN-GP 274
           VG + ++ ++E L +     G V+   ++ + E+G+ +G+GF  + D        +N   
Sbjct: 44  VGNIPYDATEEQLVQICEEVGPVVSFRLVIDKETGKPKGYGFCEYKDEETALSARRNLQG 103

Query: 275 HQLDGRTI 298
           ++++GR +
Sbjct: 104 YEINGRQL 111


>05_04_0383 -
           20801036-20801309,20801413-20801538,20801706-20801730,
           20801808-20802259,20802330-20802394,20802487-20802711,
           20804750-20804878,20805095-20805306,20806861-20806894
          Length = 513

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 16/71 (22%), Positives = 35/71 (49%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ-- 265
           +F+G L  +  +  L     + G V+D  + ++ E+ RS+G+ F  +    +    ++  
Sbjct: 9   VFIGNLDEKVPERVLYEILIQVGRVVDLHIPRDKETNRSKGYAFAEYETEEIAQYAVKLF 68

Query: 266 NGPHQLDGRTI 298
           +G  +L  RT+
Sbjct: 69  SGLVRLHNRTL 79


>10_01_0076 -
           987092-987671,987747-987812,988201-988363,988467-988548,
           989153-989202,989237-989270,990177-990239,990339-990403,
           990485-990560,991274-991353,991514-991628,991729-991830
          Length = 491

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRS--RGFGF 223
           +P+   D    LFV  L++ETS+  ++R F  YG +     +KN   G +  + +GF
Sbjct: 130 DPNATGDPYKTLFVARLNYETSEHRVKREFEAYGPIKRQTSLKNVGDGTTYLQAWGF 186


>07_03_1265 +
           25304408-25304545,25304895-25305032,25305746-25305807,
           25306321-25306423,25306560-25306636,25306915-25306971,
           25307202-25307323,25307551-25307667,25308188-25308273,
           25308387-25308560,25308671-25308940
          Length = 447

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 30/112 (26%), Positives = 47/112 (41%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG L+ E +Q+ L R F   G       ++       +GFGFV +++ +   L +Q G
Sbjct: 292 VYVGNLAHEVTQDVLHRLFHALG----AGAIEEVRIQLGKGFGFVRYSNHAEAALAIQMG 347

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTL 427
               +GR +  KP       KP   G            +VT  DL    R+L
Sbjct: 348 ----NGRILGGKPIKCSWGNKPTPPGTTSAPLPPPAAPSVTAADLLEYQRSL 395


>04_03_0630 -
           18182681-18182931,18183397-18183463,18184899-18184964,
           18185057-18185178,18185263-18185425,18186082-18186329,
           18186418-18186751,18186857-18187000,18187079-18187144
          Length = 486

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 17/67 (25%), Positives = 29/67 (43%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++V  L    + E L+  F ++G +    +   S   +   +GFV F DPS V   +   
Sbjct: 324 IYVRNLPLSATPEQLEEAFKKFGAIKPDGIQVRSHKIQGFCYGFVEFEDPSSVQSAIAGS 383

Query: 272 PHQLDGR 292
           P  +  R
Sbjct: 384 PVTISDR 390


>01_01_0386 -
           2985563-2985986,2986301-2986390,2986529-2986668,
           2986798-2986893,2987003-2987042,2987760-2987887
          Length = 305

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 34/109 (31%), Positives = 46/109 (42%), Gaps = 3/109 (2%)
 Frame = +2

Query: 65  DMDDDEKG---KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           D  DD  G   +L+VG LS  T   +L+  F RYG V   V MK+        F FV F+
Sbjct: 8   DRYDDRYGGNTRLYVGRLSSRTRTRDLEDLFGRYGRV-RYVDMKHE-------FAFVEFS 59

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLP 382
           D    +       + LDGR  D         +   RG G  + ++G  P
Sbjct: 60  DARDAD----EARYNLDGRDFDGSRMIVEFAKGVPRGPGGSREYMGRGP 104


>10_02_0023 +
           4306350-4306908,4308429-4308814,4308917-4308991,
           4309330-4309539,4309649-4309961,4310035-4310130,
           4310220-4310357,4310436-4310536,4310645-4310712,
           4310800-4310849,4311790-4311848,4312399-4312530
          Length = 728

 Score = 31.9 bits (69), Expect = 0.39
 Identities = 22/67 (32%), Positives = 36/67 (53%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           PD  +D+  +LFVGGL  +  +E+++  FS+ GEV    ++K     + +   FV +AD 
Sbjct: 247 PD-GNDKTLELFVGGLPKDCVEEDIRVVFSQCGEVESIRIVK-----KRKRIAFVRYADI 300

Query: 242 SLVNLVL 262
           S     L
Sbjct: 301 SATKKAL 307


>02_04_0589 -
           24117688-24119282,24119881-24119908,24120004-24120089,
           24120196-24120220,24121188-24121326,24122344-24122567,
           24122674-24122691
          Length = 704

 Score = 31.5 bits (68), Expect = 0.52
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++VG +S+ T++E     FSR GE+   ++  +  S    GF F+ +
Sbjct: 36  VYVGNMSFYTTEEQAYELFSRAGEIRKIIMGLDKNSKTPCGFCFILY 82


>01_07_0248 + 42261373-42261609,42261733-42261905,42261986-42262058,
            42262148-42262282,42262352-42262562,42262886-42263034,
            42263169-42263267,42263821-42263989,42264176-42264308,
            42264600-42264694,42264774-42264882,42265136-42265295,
            42265433-42265594,42265814-42265985,42266254-42266402,
            42266914-42266951,42267779-42267839,42267913-42268155,
            42268233-42268315,42269521-42269609,42270449-42270495,
            42270576-42270656,42270737-42270899,42271077-42271267,
            42271691-42271762
          Length = 1097

 Score = 31.5 bits (68), Expect = 0.52
 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 3/72 (4%)
 Frame = +2

Query: 92   LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF---ADPSLVNLVL 262
            L +  LS   ++ +L+  F  +GEV++  +  +      RG+G++ F    D     L +
Sbjct: 895  LHIDHLSRNVNEAHLKEIFGNFGEVVNVELSMDRMVNLPRGYGYIEFKKRTDAEKALLYM 954

Query: 263  QNGPHQLDGRTI 298
              G  Q+DG  +
Sbjct: 955  DGG--QIDGNVV 964


>07_03_1779 -
           29458889-29459249,29461107-29461283,29461374-29461573,
           29461673-29462752
          Length = 605

 Score = 31.1 bits (67), Expect = 0.68
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 6/48 (12%)
 Frame = +1

Query: 337 ETWRWIP*GVPW-----RAAIERYRNRSQGYFSDAMGRS-WRWSLCMI 462
           + WRW P G        RA +ER RN+   +  D++ R+ W   +C++
Sbjct: 287 QRWRWQPEGCDLPSFDARALLERLRNKRMMFVGDSLNRNQWESMVCLV 334


>07_01_0284 - 2082249-2082256,2082496-2083009
          Length = 173

 Score = 31.1 bits (67), Expect = 0.68
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +2

Query: 89  KLFVGGLSWE-TSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           +LFV G+S + T++ +L+R+F RYG V D  +       R  G+ FV    PS   L L
Sbjct: 108 RLFVFGVSKKRTTELDLRRHFKRYGYVADIWLR------RRGGYAFVQLRTPSHAALAL 160


>09_04_0716 +
           19702100-19702250,19702366-19702463,19702527-19702611,
           19702950-19703020,19703119-19703209,19703292-19703367,
           19704047-19704584
          Length = 369

 Score = 30.7 bits (66), Expect = 0.90
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 12/92 (13%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYF-----------SRYGEVIDCVVMKNSESGR 205
           +P    D    +FVG LS  T  E L++             SRYG V    ++++  +G 
Sbjct: 56  DPKATGDPYCTVFVGRLSRYTDDETLRKLLFLVVYVREQEMSRYGRVKSMRLVRDIVTGA 115

Query: 206 SRGFGFVTFADPSLVNLVLQNGPHQ-LDGRTI 298
           SRG+ FV +     +    ++  H  +DG  +
Sbjct: 116 SRGYAFVEYETDREMRRAYEDAHHSIIDGSEV 147


>04_03_0768 -
           19396146-19396607,19397855-19398175,19398424-19399569,
           19400073-19400855,19402114-19402149
          Length = 915

 Score = 30.7 bits (66), Expect = 0.90
 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQ-ENLQRYFSRYGEVIDCVVMKNSE 196
           L+V G+  E+++ E L  +F ++G+VID  +  NSE
Sbjct: 473 LYVNGIPLESNRWEALLSHFQKFGQVIDIYIPSNSE 508


>02_05_0544 +
           29876337-29876524,29876850-29876882,29878390-29878577,
           29879755-29879811,29879909-29880061,29880812-29881278,
           29881477-29881635,29881718-29881834,29881966-29882117,
           29883436-29883530,29883619-29884525,29884604-29884688,
           29884775-29884843,29885045-29885224,29885367-29885495
          Length = 992

 Score = 30.7 bits (66), Expect = 0.90
 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 1/88 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           NP   D  +G L +  L    S E +++ F  YGEV +       E+   +   F+ F D
Sbjct: 417 NPSDKDLNQGTLVIFNLDPSVSNEEVRQIFGTYGEVKEI-----RETPNKKHHKFIEFYD 471

Query: 239 PSLVNLVLQN-GPHQLDGRTIDPKPCNP 319
                  L++    ++ G+ I  +P  P
Sbjct: 472 VRAAEAALRSLNKSEIAGKRIKLEPSRP 499


>05_04_0028 +
           17302359-17302445,17303887-17303952,17305415-17305489,
           17305638-17305737,17305819-17305865,17305937-17305994,
           17306161-17306210,17306417-17306473,17306561-17306703,
           17306793-17306834,17307083-17307124,17308239-17308272,
           17308342-17308443,17310373-17310652,17311202-17311332,
           17311676-17311773,17312525-17312717
          Length = 534

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           ++VG L  +  +  ++  F +YG ++D + +K     R  G+ FV F DP
Sbjct: 9   IYVGNLPGDIREREVEDLFYKYGRIVD-IDLKIPP--RPPGYAFVEFEDP 55


>03_02_0967 +
           12786219-12786305,12786716-12786781,12786897-12786971,
           12787054-12787162,12787253-12787299,12787396-12787453,
           12788193-12788242,12788459-12788504,12788758-12788808,
           12789376-12789478,12789923-12789956,12790210-12790224
          Length = 246

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           ++VG L  +  +  ++  F +YG ++D + +K     R  G+ FV F DP
Sbjct: 9   IYVGNLPGDIREREVEDLFYKYGRIVD-IDLKIPP--RPPGYAFVEFEDP 55


>03_02_0875 +
           12038365-12039329,12039417-12039593,12039651-12039893,
           12040045-12040124,12040242-12040508,12040599-12040710,
           12040757-12041071,12041357-12041366
          Length = 722

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +2

Query: 203 RSRGFGFVTFADPSLVNLVLQNG-PHQLDGRTIDPKP 310
           + R FGFVTF  P  V L+L  G PH +    +  KP
Sbjct: 414 QKRMFGFVTFVYPETVKLILAKGNPHFICDARVLVKP 450


>01_06_1775 - 39808794-39808919,39809021-39809127,39810594-39812178
          Length = 605

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +2

Query: 179 VMKNSESGRSRGFGFVTFAD 238
           +M +  SGRSRGFGFV F++
Sbjct: 531 IMYDKNSGRSRGFGFVHFSN 550



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +3

Query: 429 GKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           G  + V IMYD+   +S G GF+ F +E
Sbjct: 524 GGHLHVRIMYDKNSGRSRGFGFVHFSNE 551


>03_05_0066 -
           20455976-20456161,20456251-20456347,20456608-20456738,
           20456814-20456869,20457498-20457543
          Length = 171

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = +2

Query: 65  DMDDDEKGK-LFVGGLSWETSQENLQRYFSRYGEVI 169
           D D D     +FVGGL    + E L++ FS YGE++
Sbjct: 25  DSDSDPNNTTVFVGGLDPSVTDEVLKQAFSPYGELV 60


>01_06_1531 +
           38024757-38024790,38025592-38025803,38026111-38026248,
           38026405-38026449,38026499-38026591,38028072-38028815
          Length = 421

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 14/71 (19%), Positives = 35/71 (49%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ-- 265
           +++G L  + ++  L     + G V+D  + ++ E+   +G+ F  +    +    +Q  
Sbjct: 9   VYIGNLDEKVTERILYEILIQPGRVVDLCIPRDKETSCPKGYAFAEYETEEIAQYAVQLF 68

Query: 266 NGPHQLDGRTI 298
           +G  +L G+T+
Sbjct: 69  SGLVRLYGKTL 79


>10_08_0922 - 21593030-21593225,21593319-21594142
          Length = 339

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 17/79 (21%), Positives = 39/79 (49%), Gaps = 4/79 (5%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYF-SRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           + +D +         +   Q+++  +F S YG  ++ V+++ + +G+   +G V    PS
Sbjct: 247 LPEDYRSLFITFSRGYPIRQDDIINFFNSLYGPCVESVMVEKAAAGQLPVYGRVVLRCPS 306

Query: 245 LVNLVL---QNGPHQLDGR 292
           ++ +VL   Q   + + GR
Sbjct: 307 MIPVVLDGQQTAKYMIKGR 325


>02_01_0174 -
           1193696-1193726,1193822-1194175,1194307-1194542,
           1194629-1194741,1195963-1196161,1196427-1196513
          Length = 339

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +F G L ++  Q  ++R FS+YG V + V MK+       GF FV   D
Sbjct: 64  VFCGNLDYDARQSEIERLFSKYGRV-ERVDMKS-------GFAFVYMED 104


>04_03_0283 +
           13887388-13887573,13887711-13887806,13888517-13888637,
           13888734-13888840,13888949-13889166,13890219-13890396,
           13890492-13890611,13891601-13891687,13892401-13892511,
           13892618-13893439
          Length = 681

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 13/47 (27%), Positives = 27/47 (57%)
 Frame = +3

Query: 249 STSCYRMDLINLMAGPSTLSRAILALFKNRNVAVDTLRCSLAGCHRT 389
           ++S + + ++ ++A P  +   I+ L +  NV   T+ C  +GCHR+
Sbjct: 7   NSSLFLIFILTMIALP-LVPYTIMRLCRAANVKAKTIHCRCSGCHRS 52


>02_01_0500 -
           3623837-3624019,3624591-3624778,3625209-3626147,
           3626311-3626479,3626701-3626871,3626948-3627016,
           3627094-3627201,3627844-3627997,3628659-3628738,
           3628822-3628914,3628951-3629073,3629165-3629915,
           3630123-3630163,3630338-3630385
          Length = 1038

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L V GL     +E L+  F+++  + D  ++++  +  SRGF F+ F
Sbjct: 441 LVVRGLDENADEEMLRYEFAKHAPIKDIRLVRDKFTHVSRGFAFIHF 487



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 4/59 (6%)
 Frame = +2

Query: 134 LQRY-FSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN-GPHQL--DGRTI 298
           LQ Y  + +G +    V+K   SG SRGF F+ F        +++  G + L  DGR +
Sbjct: 316 LQVYCLAEWGPLRSVRVIKERSSGMSRGFAFIDFPTVEAARRMMEGVGDNGLLIDGRKV 374


>01_07_0385 - 43212580-43213142,43213234-43213612
          Length = 313

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = +2

Query: 176 VVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPR 322
           +++ N  +GR   F     ADP    L+  + PH L  R   P+P  PR
Sbjct: 237 IIVDNLFTGRKENFAH-HLADPRF-ELIRGHEPHPLPARPRKPRPSGPR 283


>09_06_0309 -
           22206812-22206884,22207008-22207103,22207531-22207619,
           22207738-22207820,22207932-22208048,22208132-22208319,
           22208430-22208500,22208570-22208782,22210022-22210081,
           22210186-22210476,22210590-22211894
          Length = 861

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 4/61 (6%)
 Frame = +2

Query: 176 VVMKNSESGR-SRGFGFVTF---ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKR 343
           V+ + S  GR SRGFGF T    AD    ++V       L+G+ +D +P   +   K +R
Sbjct: 495 VMCERSSRGRFSRGFGFATMAIAADAEPADVVT-----MLNGQILDGRPLRVKFADKDQR 549

Query: 344 G 346
           G
Sbjct: 550 G 550


>07_03_1586 -
           27929947-27930056,27930143-27930286,27930377-27930704,
           27931189-27931404,27932099-27932284,27932439-27932521,
           27932621-27932752,27932943-27932999,27933352-27933412,
           27933807-27933889,27933975-27934134
          Length = 519

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           D  E+ +LFVG +    ++E++           D  V+++  +G SRG  FV
Sbjct: 7   DGGERVRLFVGQVPRSMAEEDILAVVRAAARADDATVIRDRATGASRGCCFV 58



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 11/39 (28%), Positives = 21/39 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGR 205
           KLF+G L  +  +  +   FS+YG +    V+++ +  R
Sbjct: 125 KLFIGMLPRDVKENEVSALFSQYGNIRQLKVLRSPQKTR 163


>02_02_0658 +
           12720873-12720906,12721201-12721664,12723069-12723227,
           12723308-12723424,12723570-12723721,12724594-12724685,
           12724787-12725464,12725551-12725803,12725804-12725888,
           12725969-12726037,12726489-12726668,12726989-12726994,
           12727526-12727624
          Length = 795

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 22/88 (25%), Positives = 35/88 (39%), Gaps = 1/88 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           NP   D  +G L +  L    S E L + F  +GEV +       E+   R   F+ F D
Sbjct: 221 NPSDKDMNQGTLVIFNLEPAVSNEELLQIFGAFGEVREI-----RETPHKRHHRFIEFYD 275

Query: 239 PSLVNLVLQN-GPHQLDGRTIDPKPCNP 319
                  L++     + G+ +  +P  P
Sbjct: 276 VRAAESALRSLNKSDIAGKRVKLEPSRP 303


>11_01_0293 +
           2207782-2208148,2208515-2208567,2208622-2208698,
           2209377-2209772,2209953-2210111,2210522-2210933
          Length = 487

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +1

Query: 352 IP*GVPWRAAIERYRNRSQGYFSDAMGRS-WRWSLCMI 462
           +P G   R  +E+ RN+   +  D++GR+ W   LCM+
Sbjct: 163 LPTGFDARNMLEKLRNKRVVFVGDSIGRNQWESLLCML 200


>07_03_1347 +
           25932185-25932748,25933151-25933755,25935797-25936214,
           25936433-25936555,25936775-25936989,25937157-25937412,
           25937844-25938149,25938764-25938820,25939635-25939685
          Length = 864

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           L  GG++   S  +L+ +F+RYG VI  V+++  ++ R    G + F+  S
Sbjct: 460 LVFGGVASIISPVHLESFFTRYGVVIATVLLR--DATRCERVGMLVFSAES 508


>05_04_0375 +
           20750170-20751011,20751707-20751865,20752894-20753146,
           20753287-20753316
          Length = 427

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 6/46 (13%)
 Frame = +1

Query: 343 WRWIP*--GVPW---RAAIERYRNRSQGYFSDAMGRS-WRWSLCMI 462
           WRW P     P    RAA+ER R +   +  D+M R+ W   +CM+
Sbjct: 140 WRWKPRRCDAPRFTARAALERLRGKRVVFVGDSMSRTQWESFICML 185


>04_04_0176 - 23329589-23331043
          Length = 484

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 18/74 (24%), Positives = 32/74 (43%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +F+G L + T+   ++   + +G +       +  +G+SRGF    F  P        + 
Sbjct: 126 VFIGELPYWTTDAEVEGALAPHGALHGLHFFTDKLTGKSRGFCRADFLSPD----AAASA 181

Query: 272 PHQLDGRTIDPKPC 313
              L GRT D + C
Sbjct: 182 AAALHGRTFDGRHC 195


>12_01_0754 - 6816789-6816886,6816922-6817722,6818377-6819058
          Length = 526

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +3

Query: 60  IQTWTMMRRENYLLEDYHGKHPKRTCNAIS 149
           ++ WT   R + LLED    H   TC +I+
Sbjct: 388 LKRWTRNARHDELLEDNSNNHKDATCQSIT 417


>03_02_0842 + 11682332-11683802,11683858-11683940,11684751-11686553,
            11687783-11688633,11689230-11689299,11689597-11689641
          Length = 1440

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = +2

Query: 113  WETSQENLQRYFSRYGEVID 172
            WETS+ENL++    Y EV D
Sbjct: 1377 WETSEENLEKLRELYSEVED 1396


>02_05_0807 + 31870018-31870953
          Length = 311

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +3

Query: 270 DLINLMAGPSTLSRAILALFKNRNVAVDTLRCSLAGCHRTLPKPISGXF 416
           DL+ L A  S  SRAI  +    +VAVD    S  G H   P+  +G F
Sbjct: 132 DLVRLAARGSP-SRAINVVLTADDVAVDGFCMSRCGTHGASPRSRAGRF 179


>10_01_0168 - 1883380-1883594,1884572-1888325
          Length = 1322

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = -1

Query: 125 GMFPMIVLQQIVFPSHHRPCLDSYAYLTTNYKIKV 21
           G+ P++ L     PSH + C    A    NY+I V
Sbjct: 399 GILPILKLSYADLPSHMKQCFAFCAIFPKNYEINV 433


>07_01_1143 -
           10711023-10711884,10713603-10713826,10714253-10714522,
           10715071-10715175
          Length = 486

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 10/32 (31%), Positives = 20/32 (62%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEV 166
           DD+    L++GGL    ++++L+  F  +GE+
Sbjct: 223 DDESIRTLYIGGLDSRVTEQDLRDQFYAHGEI 254


>06_01_1037 -
           8140602-8140782,8141489-8141545,8141649-8141845,
           8143174-8143242,8143347-8143490,8144055-8144225
          Length = 272

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL++  L +  ++E++Q  FS  G +  C V  ++ + R  G   V F   S     L+ 
Sbjct: 89  KLYISNLHYGVTKEDIQELFSEMGHLKHCAVHYDN-NRRPTGSAEVIFTRRSEAVAALKR 147

Query: 269 GPH-QLDGR 292
             + +LDG+
Sbjct: 148 YNNVRLDGK 156


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,992,658
Number of Sequences: 37544
Number of extensions: 358182
Number of successful extensions: 1385
Number of sequences better than 10.0: 177
Number of HSP's better than 10.0 without gapping: 1133
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1346
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1388195172
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -