SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov2p23
         (399 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_02_0326 - 8976913-8976963,8977453-8977521,8978247-8978438,897...    85   2e-17
12_02_0476 + 19493278-19493349,19493595-19494209,19494352-194945...    83   6e-17
09_06_0132 - 21042653-21042873,21042950-21043027,21043106-210431...    29   1.8  
03_02_0752 - 10922456-10922644,10922719-10922796,10922888-109230...    28   2.4  
02_01_0421 + 3080801-3081120,3081578-3081663,3081987-3082125,308...    28   2.4  
06_01_1133 + 9364842-9364850,9364929-9365048,9365157-9365476,936...    28   3.1  
11_02_0037 - 7613632-7613727,7614452-7615507                           26   9.5  

>02_02_0326 -
           8976913-8976963,8977453-8977521,8978247-8978438,
           8978597-8978764,8978902-8979513,8979765-8979815
          Length = 380

 Score = 85.0 bits (201), Expect = 2e-17
 Identities = 39/70 (55%), Positives = 44/70 (62%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR HNYLRISLTERCNLRC+YCMPA+GV                + G    +GVD
Sbjct: 67  LVDSFGRFHNYLRISLTERCNLRCQYCMPAQGVQLTPNSELLSHDEIIRVAGLFVTSGVD 126

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 127 KIRLTGGEPT 136


>12_02_0476 +
           19493278-19493349,19493595-19494209,19494352-19494519,
           19494677-19494868,19495604-19495672,19496461-19496544
          Length = 399

 Score = 83.4 bits (197), Expect = 6e-17
 Identities = 39/70 (55%), Positives = 43/70 (61%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR HNYLRISLTERCNLRC+YCMPAEGV                +      +GVD
Sbjct: 75  LVDSFGRFHNYLRISLTERCNLRCQYCMPAEGVELTPSSELLSHDEIIRVADLFVTSGVD 134

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 135 KIRLTGGEPT 144


>09_06_0132 -
           21042653-21042873,21042950-21043027,21043106-21043167,
           21043504-21043578,21043664-21043752,21043825-21043905,
           21044939-21045076,21046299-21046429,21046521-21046592,
           21047218-21047275,21047362-21047461,21047544-21047617,
           21047701-21047836,21047913-21048137,21048211-21048446,
           21048949-21049081,21049195-21049484
          Length = 732

 Score = 28.7 bits (61), Expect = 1.8
 Identities = 12/33 (36%), Positives = 15/33 (45%)
 Frame = +1

Query: 199 YMVVDTTTCEYLSLSDATCDASTACRRKACPCP 297
           Y    +TT   +  S   CD   ACR K+  CP
Sbjct: 148 YSPAQSTTSRKVPCSSNLCDLQNACRSKSNSCP 180


>03_02_0752 -
           10922456-10922644,10922719-10922796,10922888-10923016,
           10923105-10923152,10923243-10923333,10923517-10923648,
           10923869-10924086,10925121-10925271,10925360-10926009,
           10926715-10926786,10926938-10926985,10927105-10927242,
           10927750-10927756,10928064-10928212
          Length = 699

 Score = 28.3 bits (60), Expect = 2.4
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = +1

Query: 259 ASTACRRKACPCPVAARCCQWKSCG*XW 342
           A + CR + CPC  A+R C    C   W
Sbjct: 493 AKSQCRSRQCPCFAASRECDPDVCRNCW 520


>02_01_0421 +
           3080801-3081120,3081578-3081663,3081987-3082125,
           3082470-3082554
          Length = 209

 Score = 28.3 bits (60), Expect = 2.4
 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%)
 Frame = +1

Query: 271 CRRKACPCP---VAARCCQWKSCG*XWARWRPPAWTS 372
           CR   CP P   VAA   +W S      R  PP WTS
Sbjct: 68  CRHHGCPPPALRVAAAVRRWTSTLTWPTRASPPRWTS 104


>06_01_1133 +
           9364842-9364850,9364929-9365048,9365157-9365476,
           9366267-9366428,9367151-9367235,9367352-9367501,
           9367588-9367635,9367705-9367773,9367897-9368600,
           9369426-9369561,9369636-9369856,9370355-9370486,
           9371316-9371406,9371878-9371925,9372004-9372132,
           9372357-9372626
          Length = 897

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 12/27 (44%), Positives = 14/27 (51%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSCG 333
           C   +AC  K CPC     CC+ K CG
Sbjct: 651 CGCQSACG-KQCPCLTNGTCCE-KYCG 675



 Score = 27.1 bits (57), Expect = 5.5
 Identities = 11/28 (39%), Positives = 13/28 (46%)
 Frame = +1

Query: 259 ASTACRRKACPCPVAARCCQWKSCG*XW 342
           A + CR + CPC  A R C    C   W
Sbjct: 690 AKSQCRSRQCPCFAADRECDPDVCRNCW 717


>11_02_0037 - 7613632-7613727,7614452-7615507
          Length = 383

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -1

Query: 183 PPPPHGCHH 157
           PPPPHG HH
Sbjct: 256 PPPPHGHHH 264


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,363,965
Number of Sequences: 37544
Number of extensions: 245981
Number of successful extensions: 686
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 675
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 683
length of database: 14,793,348
effective HSP length: 75
effective length of database: 11,977,548
effective search space used: 682720236
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -