BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov2p23 (399 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0326 - 8976913-8976963,8977453-8977521,8978247-8978438,897... 85 2e-17 12_02_0476 + 19493278-19493349,19493595-19494209,19494352-194945... 83 6e-17 09_06_0132 - 21042653-21042873,21042950-21043027,21043106-210431... 29 1.8 03_02_0752 - 10922456-10922644,10922719-10922796,10922888-109230... 28 2.4 02_01_0421 + 3080801-3081120,3081578-3081663,3081987-3082125,308... 28 2.4 06_01_1133 + 9364842-9364850,9364929-9365048,9365157-9365476,936... 28 3.1 11_02_0037 - 7613632-7613727,7614452-7615507 26 9.5 >02_02_0326 - 8976913-8976963,8977453-8977521,8978247-8978438, 8978597-8978764,8978902-8979513,8979765-8979815 Length = 380 Score = 85.0 bits (201), Expect = 2e-17 Identities = 39/70 (55%), Positives = 44/70 (62%) Frame = +3 Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368 L D GR HNYLRISLTERCNLRC+YCMPA+GV + G +GVD Sbjct: 67 LVDSFGRFHNYLRISLTERCNLRCQYCMPAQGVQLTPNSELLSHDEIIRVAGLFVTSGVD 126 Query: 369 KLRXTGGEPT 398 K+R TGGEPT Sbjct: 127 KIRLTGGEPT 136 >12_02_0476 + 19493278-19493349,19493595-19494209,19494352-19494519, 19494677-19494868,19495604-19495672,19496461-19496544 Length = 399 Score = 83.4 bits (197), Expect = 6e-17 Identities = 39/70 (55%), Positives = 43/70 (61%) Frame = +3 Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368 L D GR HNYLRISLTERCNLRC+YCMPAEGV + +GVD Sbjct: 75 LVDSFGRFHNYLRISLTERCNLRCQYCMPAEGVELTPSSELLSHDEIIRVADLFVTSGVD 134 Query: 369 KLRXTGGEPT 398 K+R TGGEPT Sbjct: 135 KIRLTGGEPT 144 >09_06_0132 - 21042653-21042873,21042950-21043027,21043106-21043167, 21043504-21043578,21043664-21043752,21043825-21043905, 21044939-21045076,21046299-21046429,21046521-21046592, 21047218-21047275,21047362-21047461,21047544-21047617, 21047701-21047836,21047913-21048137,21048211-21048446, 21048949-21049081,21049195-21049484 Length = 732 Score = 28.7 bits (61), Expect = 1.8 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 199 YMVVDTTTCEYLSLSDATCDASTACRRKACPCP 297 Y +TT + S CD ACR K+ CP Sbjct: 148 YSPAQSTTSRKVPCSSNLCDLQNACRSKSNSCP 180 >03_02_0752 - 10922456-10922644,10922719-10922796,10922888-10923016, 10923105-10923152,10923243-10923333,10923517-10923648, 10923869-10924086,10925121-10925271,10925360-10926009, 10926715-10926786,10926938-10926985,10927105-10927242, 10927750-10927756,10928064-10928212 Length = 699 Score = 28.3 bits (60), Expect = 2.4 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 259 ASTACRRKACPCPVAARCCQWKSCG*XW 342 A + CR + CPC A+R C C W Sbjct: 493 AKSQCRSRQCPCFAASRECDPDVCRNCW 520 >02_01_0421 + 3080801-3081120,3081578-3081663,3081987-3082125, 3082470-3082554 Length = 209 Score = 28.3 bits (60), Expect = 2.4 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 271 CRRKACPCP---VAARCCQWKSCG*XWARWRPPAWTS 372 CR CP P VAA +W S R PP WTS Sbjct: 68 CRHHGCPPPALRVAAAVRRWTSTLTWPTRASPPRWTS 104 >06_01_1133 + 9364842-9364850,9364929-9365048,9365157-9365476, 9366267-9366428,9367151-9367235,9367352-9367501, 9367588-9367635,9367705-9367773,9367897-9368600, 9369426-9369561,9369636-9369856,9370355-9370486, 9371316-9371406,9371878-9371925,9372004-9372132, 9372357-9372626 Length = 897 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 253 CDASTACRRKACPCPVAARCCQWKSCG 333 C +AC K CPC CC+ K CG Sbjct: 651 CGCQSACG-KQCPCLTNGTCCE-KYCG 675 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 259 ASTACRRKACPCPVAARCCQWKSCG*XW 342 A + CR + CPC A R C C W Sbjct: 690 AKSQCRSRQCPCFAADRECDPDVCRNCW 717 >11_02_0037 - 7613632-7613727,7614452-7615507 Length = 383 Score = 26.2 bits (55), Expect = 9.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 183 PPPPHGCHH 157 PPPPHG HH Sbjct: 256 PPPPHGHHH 264 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,363,965 Number of Sequences: 37544 Number of extensions: 245981 Number of successful extensions: 686 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -